From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN001425000
  • symbol?:
  • description?: prophage L54a, antirepressor

      descriptions from strain specific annotations:

    • prophage L54a, antirepressor
    • bacteriophage L54a antirepressor
    • phage anti-repressor protein
    • bacteriophage L54a, antirepressor
    • phage protein
    • prophage antirepressor
  • strand?: +
  • coordinates?: 1704233..1705024
  • synteny block?: BlockID0009030
  • occurrence?: in 16% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    08BA02176:
    11819-97:
    71193:
    ECT-R 2:
    ED133:
    ED98:
    HO 5096 0412:
    JH1:
    JH9:
    JKD6008:
    SAA6008_01890
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    MSHR1132:
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    SATW20_03320
    USA300_TCH1516:
    VC40:

Genome Viewer[edit source | edit]

COL chromosome
NCTC8325 chromosome
Newman chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQALQTFNFKELPVRTVEIENEPYFVGKDIAEILGYARSDNAIRNHVDSEDKLTHQFSAS
    NCTC8325        MQALQTFNFKELPVRTVEIENEPYFVGKDIAEILGYARSDNAIRNHVDSEDKLTHQFSAS
    Newman          MQALQTFNFKELPVRTVEIENEPYFVGKDIAEILGYARADNAIRNHVDSEDKLTHQFSAS
                    **************************************:*********************

    COL             GQNRNMIIINESGLYSLIFDASKQSKNEKIRETARKFKRWVTSDVLPAIRKHGIYATDNV
    NCTC8325        GQNRNMIIINESGLYSLIFDASKQSKNEKIRETARKFKRWVTSDVLPAIRKHGIYATDNV
    Newman          GQNRNMIIINESGLYSLIFDASKQSKNEKIRETARKFKRWVTSDVLPAIRKHGIYATDNV
                    ************************************************************

    COL             IEQTLKDPDYIITVLTEYKKEKEQNLLLQQEIGELKPKADYVDEILKSTGTLATTQIAAD
    NCTC8325        IEQTLKDPDYIITVLTEYKKEKEQNLLLQQEIGELKPKADYVDEILKSTGTLATTQIAAD
    Newman          IEQTLKDPDYIITVLTEYKKEKEQNLLLQQEIGELKPKADYVDEILKSTGTLATTQIAAD
                    ************************************************************

    COL             YGISAQKLNKLLHEARLQRKVNKQWVLYSEHMGKSYTESDTIAIVRSDGREDTVLQTRWT
    NCTC8325        YGISAQKLNKLLHEARLQRKVNKQWVLYSEHMGKSYTDSDTITIVRSDGREDTVLQTRWT
    Newman          YGISAQKLNKLLHEARLQRKVNKQWVLYSEHMGKSYTESDTIPIVRSDGREDTVLQTRWT
                    *************************************:****.*****************

    COL             QKGRLKIHEIMTEFGYEANLGGA
    NCTC8325        QKGRLKIHEIMTEFGYEANLGGA
    Newman          QKGRLKIHEIMTEFGYEANV-TA
                    *******************:  *