From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1106 [new locus tag: NWMN_RS06255 ]
  • pan locus tag?: SAUPAN003472000
  • symbol: NWMN_1106
  • pan gene symbol?:
  • synonym:
  • product: putative transposase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1106 [new locus tag: NWMN_RS06255 ]
  • symbol: NWMN_1106
  • product: putative transposase
  • replicon: chromosome
  • strand: -
  • coordinates: 1210988..1211197
  • length: 210
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    TTGAGTTTCACTCGAATGTCAGTTCGAGGAATAAATAAAGTTAAACGAGAGCTAGGTTTT
    GTATTAATGGCAATTAATATAAGGAAAATAGCAGCTCAACGAGCTGTACATTATAAAATA
    CATATCAAAAAAGCTGATTTCTATCAAATAATTAATAGAAATCAGCTTTTTACATTGCCT
    AAGAACTTAATGTCCCAGCCTCCTTCATAA
    60
    120
    180
    210

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1106 [new locus tag: NWMN_RS06255 ]
  • symbol: NWMN_1106
  • description: putative transposase
  • length: 69
  • theoretical pI: 11.9997
  • theoretical MW: 8072.64
  • GRAVY: -0.17971

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Mobile element protein 
  • PFAM:
    RNase_H (CL0219) DDE_Tnp_1_6; Transposase DDE domain (PF13751; HMM-score: 16.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.5
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: 2
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.196
    • Ymax_pos: 17
    • Cmax: 0.112
    • Cmax_pos: 34
    • Smax: 0.489
    • Smax_pos: 7
    • Smean: 0.346
    • D: 0.254
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MSFTRMSVRGINKVKRELGFVLMAINIRKIAAQRAVHYKIHIKKADFYQIINRNQLFTLPKNLMSQPPS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_1106 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]