From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1170 [new locus tag: NWMN_RS06600 ]
  • pan locus tag?: SAUPAN003561000
  • symbol: uppS
  • pan gene symbol?: uppS
  • synonym:
  • product: undecaprenyl pyrophosphate synthase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1170 [new locus tag: NWMN_RS06600 ]
  • symbol: uppS
  • product: undecaprenyl pyrophosphate synthase
  • replicon: chromosome
  • strand: +
  • coordinates: 1284412..1285182
  • length: 771
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGTTTAAAAAGCTAATAAATAAAAAGAACACTATAAATAATTATAATGAAGAATTAGAC
    TCGTCTAATATACCTGAACATATCGCTATTATTATGGATGGTAATGGGCGATGGGCTAAG
    AAGCGAAAAATGCCTAGAATTAAAGGTCATTACGAAGGTATGCAAACAATAAAAAAAATT
    ACTAGGGTAGCTAGTGATATTGGTGTTAAGTACTTAACTTTATACGCCTTTTCCACTGAA
    AATTGGTCAAGACCTGAAAGTGAAGTAAATTATATTATGAATTTGCCTGTCAATTTCTTA
    AAGACATTCTTACCGGAACTAATTGAAAAAAATGTCAAAGTTGAAACAATTGGATTTACT
    GATAAGTTGCCAAAATCAACGATAGAAGCAATTAATAATGCTAAAGAAAAGACAGCTAAT
    AATACCGGCTTAAAATTAATATTTGCAATTAATTATGGTGGCAGAGCAGAACTTGTTCAT
    AGTATTAAAAATATGTTTGACGAGCTTCATCAACAAGGTTTAAATAGTGATATCATAGAT
    GAAACATATATAAACAATCATTTAATGACAAAAGACTATCCTGATCCAGAGTTGTTAATT
    CGTACTTCAGGAGAACAAAGAATAAGTAATTTCTTGATTTGGCAAGTTTCGTATAGTGAA
    TTTATCTTTAATCAAAAATTATGGCCTGACTTTGACGAAGATGAATTAATTAAATGTATA
    AAAATTTATCAGTCACGTCAAAGACGCTTTGGCGGATTGAGTGAGGAGTAG
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    771

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1170 [new locus tag: NWMN_RS06600 ]
  • symbol: UppS
  • description: undecaprenyl pyrophosphate synthase
  • length: 256
  • theoretical pI: 8.36963
  • theoretical MW: 29848
  • GRAVY: -0.545313

Function[edit source | edit]

  • reaction:
    EC 2.5.1.-?  ExPASy
  • TIGRFAM:
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesdi-trans,poly-cis-decaprenylcistransferase (TIGR00055; EC 2.5.1.31; HMM-score: 274.9)
  • TheSEED:  
    Fatty Acids, Lipids, and IsoprenoidsIsoprenoidsIsoprenoid Biosynthesis Undecaprenyl diphosphate synthase (EC 2.5.1.31) 
    IsoprenoidsIsoprenoinds for Quinones Undecaprenyl diphosphate synthase (EC 2.5.1.31) 
    IsoprenoidsPolyprenyl Diphosphate Biosynthesis Undecaprenyl diphosphate synthase (EC 2.5.1.31) 
  • PFAM:
    no clan definedPrenyltransf; Putative undecaprenyl diphosphate synthase (PF01255; HMM-score: 267.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Mg2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.133
    • Ymax_pos: 15
    • Cmax: 0.137
    • Cmax_pos: 40
    • Smax: 0.238
    • Smax_pos: 9
    • Smean: 0.172
    • D: 0.148
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MFKKLINKKNTINNYNEELDSSNIPEHIAIIMDGNGRWAKKRKMPRIKGHYEGMQTIKKITRVASDIGVKYLTLYAFSTENWSRPESEVNYIMNLPVNFLKTFLPELIEKNVKVETIGFTDKLPKSTIEAINNAKEKTANNTGLKLIFAINYGGRAELVHSIKNMFDELHQQGLNSDIIDETYINNHLMTKDYPDPELLIRTSGEQRISNFLIWQVSYSEFIFNQKLWPDFDEDELIKCIKIYQSRQRRFGGLSEE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]