From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1339 [new locus tag: NWMN_RS07545 ]
  • pan locus tag?: SAUPAN003860000
  • symbol: NWMN_1339
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1339 [new locus tag: NWMN_RS07545 ]
  • symbol: NWMN_1339
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1472025..1472462
  • length: 438
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAATGCATATGATGCTTATATGAAAGAAATTGCGCAACAAATGCGTGGCGAATTAACT
    CAAAATGGTTTTACAAGTTTAGAAACGAGCGAAGCAGTATCGGAGTATATGAACCAAGTA
    AATGCTGATGACACTACTTTTGTAGTTATTAACTCTACATGCGGCTGTGCAGCTGGATTA
    GCAAGACCAGCTGCAGTAGCAGTTGCAACACAAAATGAACATAGACCTACAAATACAGTT
    ACAGTTTTTGCTGGGCAAGATAAAGAAGCAACTGCTACAATGCGAGAATTCATTCAGCAA
    GCACCATCTAGTCCTTCGTATGCTTTATTCAAAGGTCAAGATTTAGTTTATTTTATGCCT
    AGAGAATTTATCGAAGGTAGAGATATTAATGACATTGCAATGGACTTAAAGGATGCCTTT
    GACGAAAATTGTAAATAG
    60
    120
    180
    240
    300
    360
    420
    438

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1339 [new locus tag: NWMN_RS07545 ]
  • symbol: NWMN_1339
  • description: hypothetical protein
  • length: 145
  • theoretical pI: 4.14983
  • theoretical MW: 16013.8
  • GRAVY: -0.362069

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    putative bacilliredoxin, YphP/YqiW family (TIGR04191; EC 1.-.-.-; HMM-score: 181.9)
  • TheSEED:  
    UPF0403 membrane protein YphP/YqiW family 
  • PFAM:
    no clan definedDisulph_isomer; Disulphide isomerase (PF06491; HMM-score: 179.6)
    LytR_C; LytR cell envelope-related transcriptional attenuator (PF13399; HMM-score: 16.8)
    THBO-biosyn (CL0334) GCHY-1; Type I GTP cyclohydrolase folE2 (PF02649; HMM-score: 13.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 0.67
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.206
    • Ymax_pos: 43
    • Cmax: 0.305
    • Cmax_pos: 43
    • Smax: 0.224
    • Smax_pos: 63
    • Smean: 0.118
    • D: 0.172
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNAYDAYMKEIAQQMRGELTQNGFTSLETSEAVSEYMNQVNADDTTFVVINSTCGCAAGLARPAAVAVATQNEHRPTNTVTVFAGQDKEATATMREFIQQAPSSPSYALFKGQDLVYFMPREFIEGRDINDIAMDLKDAFDENCK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]