From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003860000
  • symbol?:
  • description?: protein YphP

      descriptions from strain specific annotations:

    • protein YphP
    • YqiW like protein
  • strand?: -
  • coordinates?: 4141829..4142266
  • synteny block?: BlockID0029160
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1382
    08BA02176:
    C248_1468
    11819-97:
    MS7_1384
    71193:
    ST398NM01_1429
    ECT-R 2:
    ECTR2_1284
    ED133:
    SAOV_1437c
    ED98:
    SAAV_1411
    HO 5096 0412:
    SAEMRSA15_12910
    JH1:
    SaurJH1_1517
    JH9:
    SaurJH9_1488
    JKD6008:
    SAA6008_01396
    JKD6159:
    SAA6159_01295
    LGA251:
    SARLGA251_13440
    M013:
    M013TW_1374
    MRSA252:
    SAR1441
    MSHR1132:
    SAMSHR1132_12700
    MSSA476:
    SAS1371
    Mu3:
    SAHV_1416
    Mu50:
    SAV1428
    MW2:
    MW1318
    RF122:
    SAB1283c
    ST398:
    SAPIG1429
    T0131:
    SAT0131_01508
    TCH60:
    HMPREF0772_11778
    TW20:
    SATW20_14290
    USA300_TCH1516:
    USA300HOU_1365
    VC40:
    SAVC_06390

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNAYDAYMKEIAQQMRGELTQNGFTSLETSEAVSEYMNQVNADDTTFVVINSTCGCAAGL
    N315            MNAYDAYMKEIAQQMRGELTQNGFTSLETSEAVSEYMNQVNADDTTFVVINSTCGCAAGL
    NCTC8325        MNAYDAYMKEIAQQMRGELTQNGFTSLETSEAVSEYMNQVNADDTTFVVINSTCGCAAGL
    Newman          MNAYDAYMKEIAQQMRGELTQNGFTSLETSEAVSEYMNQVNADDTTFVVINSTCGCAAGL
    USA300_FPR3757  MNAYDAYMKEIAQQMRGELTQNGFTSLETSEAVSEYMNQVNADDTTFVVINSTCGCAAGL
                    ************************************************************

    COL             ARPAAVAVATQNEHRPTNTVTVFAGQDKEATATMREFIQQAPSSPSYALFKGQDLVYFMP
    N315            ARPAAVAVATQNEHRPTNTVTVFAGQDKEATATMREFIQQAPSSPSYALFKGQDLVYFMP
    NCTC8325        ARPAAVAVATQNEHRPTNTVTVFAGQDKEATATMREFIQQAPSSPSYALFKGQDLVYFMP
    Newman          ARPAAVAVATQNEHRPTNTVTVFAGQDKEATATMREFIQQAPSSPSYALFKGQDLVYFMP
    USA300_FPR3757  ARPAAVAVATQNEHRPTNTVTVFAGQDKEATATMREFIQQAPSSPSYALFKGQDLVYFMP
                    ************************************************************

    COL             REFIEGRDINDIAMDLKDAFDENCK
    N315            REFIEGRDINDIAMDLKDAFDENCK
    NCTC8325        REFIEGRDINDIAMDLKDAFDENCK
    Newman          REFIEGRDINDIAMDLKDAFDENCK
    USA300_FPR3757  REFIEGRDINDIAMDLKDAFDENCK
                    *************************