From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1381 [new locus tag: NWMN_RS07775 ]
  • pan locus tag?: SAUPAN003932000
  • symbol: NWMN_1381
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1381 [new locus tag: NWMN_RS07775 ]
  • symbol: NWMN_1381
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1547445..1548017
  • length: 573
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    ATGGAAACAACTGTTAGCAAATTGGAAAGACAAATAGAAGAAAGATTAAAGGGCGTATCA
    GAATATGAATCCATTAATATTAATCATCGGTTAGGTAAGTTACTTGATTTATATGATATT
    CCAGATGTTGCCAAAGTGGCATGCCTCACAATTGACACATCAATGAGACACCTTGATGAC
    ATTACATATAATCATTTGTCTAAACATTCCATTTTGATTGGAGATTTAATTAGTGCACAT
    TTTTATACGCTACTAGCAGAAATCAATGATTTATCATTTCAAAATGAAATTAGTAAAGCA
    ATTGTTGAAATTAATGAATTGAAATCTTCATTACATCATCAAGCTTTAAATGATTATGAA
    ATTTCTCAAGCAATAGTAAAAATTGAAACACTTTTCCCATATATTACGTTATCTCATTTC
    GGTATCAATATTGATGAGTCGGAAATATATAATTATTTATTTGAAGATATGTCTGATTAC
    TATCCATCATACTTCAAGAAATATAATCAAAGTGAAGTAAAGCATTACTTACACGATATC
    CAAAAAAGTTATTTAAAAAGTAGAGGTAATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    573

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1381 [new locus tag: NWMN_RS07775 ]
  • symbol: NWMN_1381
  • description: hypothetical protein
  • length: 190
  • theoretical pI: 5.27182
  • theoretical MW: 22183.9
  • GRAVY: -0.352105

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Fatty Acids, Lipids, and IsoprenoidsIsoprenoidsIsoprenoid scratch Heptaprenyl diphosphate synthase component I (EC 2.5.1.30) 
    IsoprenoidsIsoprenoinds for Quinones Heptaprenyl diphosphate synthase component I (EC 2.5.1.30) 
    IsoprenoidsPolyprenyl Diphosphate Biosynthesis Heptaprenyl diphosphate synthase component I (EC 2.5.1.30) 
    Regulation and Cell signalingRegulation and Cell signaling - no subcategorySex pheromones in Enterococcus faecalis and other Firmicutes Heptaprenyl diphosphate synthase component I (EC 2.5.1.30) 
  • PFAM:
    Terp_synthase (CL0613) HEPPP_synt_1; Heptaprenyl diphosphate synthase (HEPPP synthase) subunit 1 (PF07307; HMM-score: 34.7)
    YqbG (CL0643) DUF3199; Protein of unknown function (DUF3199) (PF11436; HMM-score: 8.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.109
    • Ymax_pos: 23
    • Cmax: 0.123
    • Cmax_pos: 47
    • Smax: 0.171
    • Smax_pos: 17
    • Smean: 0.115
    • D: 0.112
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • METTVSKLERQIEERLKGVSEYESININHRLGKLLDLYDIPDVAKVACLTIDTSMRHLDDITYNHLSKHSILIGDLISAHFYTLLAEINDLSFQNEISKAIVEINELKSSLHHQALNDYEISQAIVKIETLFPYITLSHFGINIDESEIYNYLFEDMSDYYPSYFKKYNQSEVKHYLHDIQKSYLKSRGN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]