From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1401 [new locus tag: NWMN_RS07910 ]
  • pan locus tag?: SAUPAN004026000
  • symbol: rluB
  • pan gene symbol?: rluB
  • synonym:
  • product: ribosomal large subunit pseudouridine synthase B

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1401 [new locus tag: NWMN_RS07910 ]
  • symbol: rluB
  • product: ribosomal large subunit pseudouridine synthase B
  • replicon: chromosome
  • strand: -
  • coordinates: 1571122..1571859
  • length: 738
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGACTAAAGAATTAGAACGATTACAAAAACGTATAGCTAATAGCGGTTATACTTCAAGA
    CGTAAGGCAGAAACTTTAATTTCTGAAGGAAAAGTGAAAGTGAATGGTACGACTGTCACT
    GAATTAGGAACAAAAGTGAAGCCATCAGATACGATTGAAGTTGAAGGTATTAAAATAGAA
    CTAGAAGACAAAATTTACATTTTATTCCATAAACCAACTCAAGTGATAACAAGTGTATCT
    GATGATAGAGGACGTACAGTGGTTACAGATTACTTTAAAGATATAGAAGCACGTATTTAT
    CCTGTTGGTCGTTTAGACTATGATACTTCTGGATTGTTATTACTCACAAATGATGGTGAA
    TTTACTAATTTAATGACACATCCAAGATATCAAATTAAGAAAAAATATGTTGCGAAATTA
    AAAGGTTATTTAATGAGAGAAGAAGTGAAAGCGCTAGAAAAAGGTATTGAATTAGAAGAT
    GGTATGACGCAACCGGCTGAAGTGAAAGTTAAGAAACAAGATAAAGATAAAAACACAACA
    TTGGTTGAAATTACAATTACAGAAGGTCGTAATCGCCAAGTCAGAAGAATGTTCGAACAT
    TTTGGTCATCAAGTGACGAAACTGTCTCGTATTGAATATGGGCCTTTAAATGTTGTCGGT
    TTGAATGCTGGTGAAGGACGTGTATTGACGCCTCATGAAGTAAAAGTGATGCGTCATTTA
    GCAGAACATGGGAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    738

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1401 [new locus tag: NWMN_RS07910 ]
  • symbol: RluB
  • description: ribosomal large subunit pseudouridine synthase B
  • length: 245
  • theoretical pI: 9.8648
  • theoretical MW: 27969
  • GRAVY: -0.606122

Function[edit source | edit]

  • reaction:
    EC 5.4.99.-?  ExPASy
  • TIGRFAM:
    Genetic information processingProtein synthesistRNA and rRNA base modificationpseudouridine synthase (TIGR00093; EC 5.4.99.-; HMM-score: 167)
    Genetic information processingProtein synthesistRNA and rRNA base modificationpseudouridine synthase, RluA family (TIGR00005; EC 5.4.99.-; HMM-score: 60.7)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairS4 domain protein YaaA (TIGR02988; HMM-score: 20.7)
    MetabolismEnergy metabolismPhotosynthesisphotosystem II S4 domain protein (TIGR03069; HMM-score: 19.1)
    Unknown functionGeneralTlyA family rRNA methyltransferase/putative hemolysin (TIGR00478; HMM-score: 17.4)
    Genetic information processingProtein synthesisRibosomal proteins: synthesis and modificationribosomal protein uS4 (TIGR01017; HMM-score: 17.1)
    Genetic information processingProtein synthesistRNA and rRNA base modificationpseudouridine synthase Rlu family protein, TIGR01621 (TIGR01621; EC 5.4.99.-; HMM-score: 16.3)
  • TheSEED:  
    Two cell division clusters relating to chromosome partitioning Ribosomal large subunit pseudouridine synthase B (EC 5.4.99.22) 
  • PFAM:
    PseudoU_synth (CL0649) PseudoU_synth_2; RNA pseudouridylate synthase (PF00849; HMM-score: 82.9)
    S4 (CL0492) S4; S4 domain (PF01479; HMM-score: 50.2)
    S4_2; S4 domain (PF13275; HMM-score: 25.4)
    TPR (CL0020) PPR_long; Pentacotripeptide-repeat region of PRORP (PF17177; HMM-score: 17.7)
    no clan definedPX; PX domain (PF00787; HMM-score: 15)
    SUKH (CL0526) SUKH-3; SUKH-3 immunity protein (PF14433; HMM-score: 15)
    tRNA_bind_arm (CL0298) Val_tRNA-synt_C; Valyl tRNA synthetase tRNA binding arm (PF10458; HMM-score: 14.3)
    HTH (CL0123) DUF4364; Domain of unknown function (DUF4364) (PF14277; HMM-score: 13.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.14
    • Ymax_pos: 24
    • Cmax: 0.147
    • Cmax_pos: 24
    • Smax: 0.257
    • Smax_pos: 11
    • Smean: 0.152
    • D: 0.145
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTKELERLQKRIANSGYTSRRKAETLISEGKVKVNGTTVTELGTKVKPSDTIEVEGIKIELEDKIYILFHKPTQVITSVSDDRGRTVVTDYFKDIEARIYPVGRLDYDTSGLLLLTNDGEFTNLMTHPRYQIKKKYVAKLKGYLMREEVKALEKGIELEDGMTQPAEVKVKKQDKDKNTTLVEITITEGRNRQVRRMFEHFGHQVTKLSRIEYGPLNVVGLNAGEGRVLTPHEVKVMRHLAEHGK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]