From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1432 [new locus tag: NWMN_RS08085 ]
  • pan locus tag?: SAUPAN004082000
  • symbol: accB
  • pan gene symbol?: accB
  • synonym:
  • product: acetyl-CoA carboxylase, biotin carboxyl carrier protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1432 [new locus tag: NWMN_RS08085 ]
  • symbol: accB
  • product: acetyl-CoA carboxylase, biotin carboxyl carrier protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1603482..1603946
  • length: 465
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGAACTTTAAAGAAATCAAAGAATTAATTGAAATTCTGGATAAATCAACTTTAACGGAA
    ATCAATATTGAAGATACTAAAGGCAAAGTGACGCTTAAGAAAGAAAAAGAAACTGAGATT
    ATCACGCCACAAATCTCACAAATGCCAGTTGAAGCTGCGGCAATGCCTATGCCTCAAGCA
    CAATCAACTGATAGCAATAAAACTGAAGCTCCAAAGCCAACTTCAGATAATCACAAAACA
    ATTAATGCACCTATGGTAGGTACATTTTACAAATCGCCATCTCCAGACGAAGAAGCATAT
    GTGCAAGTTGGGGACACTGTTTCAAATGAAACAACAGTGTGTATTTTAGAGGCAATGAAA
    CTATTTAATGAAATTCAAGCAGAAATTTCAGGTGAAATTGTTGAAATCTTAGTAGAAGAC
    GGACAAATGGTAGAGTATGGCCAACCGTTATTTAAGGTGAAATAA
    60
    120
    180
    240
    300
    360
    420
    465

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1432 [new locus tag: NWMN_RS08085 ]
  • symbol: AccB
  • description: acetyl-CoA carboxylase, biotin carboxyl carrier protein
  • length: 154
  • theoretical pI: 4.2253
  • theoretical MW: 17121.4
  • GRAVY: -0.423377

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismFatty acid and phospholipid metabolismBiosynthesisacetyl-CoA carboxylase, biotin carboxyl carrier protein (TIGR00531; HMM-score: 170.6)
    MetabolismCentral intermediary metabolismNitrogen metabolismurea carboxylase (TIGR02712; EC 6.3.4.6; HMM-score: 39.4)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsoxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 38.5)
    MetabolismEnergy metabolismOtheroxaloacetate decarboxylase alpha subunit (TIGR01108; EC 4.1.1.3; HMM-score: 38.5)
    MetabolismEnergy metabolismPyruvate dehydrogenasedihydrolipoyllysine-residue acetyltransferase (TIGR01348; EC 2.3.1.12; HMM-score: 31.1)
    MetabolismEnergy metabolismGlycolysis/gluconeogenesispyruvate carboxylase (TIGR01235; EC 6.4.1.1; HMM-score: 30.1)
    MetabolismEnergy metabolismTCA cycledihydrolipoyllysine-residue succinyltransferase, E2 component of oxoglutarate dehydrogenase (succinyl-transferring) complex (TIGR01347; EC 2.3.1.61; HMM-score: 22.2)
    MetabolismTransport and binding proteinsUnknown substrateefflux transporter, RND family, MFP subunit (TIGR01730; HMM-score: 22)
    Cellular processesCellular processesBiosynthesis of natural productsNHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 16.3)
    MetabolismTransport and binding proteinsAmino acids, peptides and aminesNHLM bacteriocin system secretion protein (TIGR03794; HMM-score: 16.3)
    MetabolismTransport and binding proteinsOtherefflux pump membrane protein (TIGR00998; HMM-score: 15)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype I secretion membrane fusion protein, HlyD family (TIGR01843; HMM-score: 14.9)
    Cell structureCell envelopeOtheruncharacterized lipoprotein (TIGR02722; HMM-score: 14.7)
    glycine cleavage protein H-like protein (TIGR03077; HMM-score: 13.7)
    MetabolismEnergy metabolismAmino acids and aminesglycine cleavage system H protein (TIGR00527; HMM-score: 13.3)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairUV excision repair protein Rad23 (TIGR00601; HMM-score: 13)
    2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase (TIGR02927; EC 2.3.1.61; HMM-score: 10.2)
  • TheSEED:  
    Fatty Acids, Lipids, and IsoprenoidsFatty acidsFatty Acid Biosynthesis FASII Biotin carboxyl carrier protein of acetyl-CoA carboxylase 
    MiscellaneousMiscellaneous - no subcategoryEC 6.3.4.- Ligases that form carbon-nitrogen bonds Biotin carboxyl carrier protein of acetyl-CoA carboxylase 
  • PFAM:
    Hybrid (CL0105) Biotin_lipoyl; Biotin-requiring enzyme (PF00364; HMM-score: 80.6)
    Biotin_lipoyl_2; Biotin-lipoyl like (PF13533; HMM-score: 30.1)
    GCV_H; Glycine cleavage H-protein (PF01597; HMM-score: 20.7)
    HlyD_3; HlyD family secretion protein (PF13437; HMM-score: 19.1)
    HlyD_D23; Barrel-sandwich domain of CusB or HlyD membrane-fusion (PF16576; HMM-score: 14.8)
    RnfC_N; RnfC Barrel sandwich hybrid domain (PF13375; HMM-score: 12.2)
    no clan definedDicty_REP; Dictyostelium (Slime Mold) REP protein (PF05086; HMM-score: 11.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.123
    • Ymax_pos: 55
    • Cmax: 0.148
    • Cmax_pos: 55
    • Smax: 0.209
    • Smax_pos: 2
    • Smean: 0.107
    • D: 0.117
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNFKEIKELIEILDKSTLTEINIEDTKGKVTLKKEKETEIITPQISQMPVEAAAMPMPQAQSTDSNKTEAPKPTSDNHKTINAPMVGTFYKSPSPDEEAYVQVGDTVSNETTVCILEAMKLFNEIQAEISGEIVEILVEDGQMVEYGQPLFKVK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]