From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1500 [new locus tag: NWMN_RS08440 ]
  • pan locus tag?: SAUPAN004184000
  • symbol: NWMN_1500
  • pan gene symbol?:
  • synonym:
  • product: HAD superfamily hydrolase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1500 [new locus tag: NWMN_RS08440 ]
  • symbol: NWMN_1500
  • product: HAD superfamily hydrolase
  • replicon: chromosome
  • strand: -
  • coordinates: 1666151..1666678
  • length: 528
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGGGTTTAGTTCGCAAGTTTTTTATGCCGAATTCATATGTTCAATCAATATTTCAAATT
    GATTTAGACAAGTTAGTGGACAAAGGCGTTAAAGGTATTATTACAGATTTAGATAATACG
    CTAGTAGGTTGGGATGTTAAAGAACCTACAGAACGTGTTAAAGCATGGTTTAAGGAAGCT
    AATGAAAAAGGAATCACTATTACAATCGTGTCTAATAATAATGAGTCTCGTGTTGCTAGT
    TTTAGTCAGCATTTAGACATCGATTTTATTTTTAAAGCGAGAAAGCCAATGGGGAAAGCG
    TTTGATAAAGCAATAACTAAGATGAATATCAGACCAGATCAAACTGTTGTTATAGGTGAC
    CAAATGCTTACTGATGTATTTGGTGGTAATCGTCGAGGTCTATATACAATTATGGTTGTT
    CCAGTTAAACGAACTGATGGCTTTATTACTAAGTTTAATAGATTAATTGAAAGACGATTA
    TTACGTCATTTCAGTAAAAAAGGTTATATCACATGGGAGGAAAATTGA
    60
    120
    180
    240
    300
    360
    420
    480
    528

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1500 [new locus tag: NWMN_RS08440 ]
  • symbol: NWMN_1500
  • description: HAD superfamily hydrolase
  • length: 175
  • theoretical pI: 10.4084
  • theoretical MW: 20219.4
  • GRAVY: -0.305714

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    HAD phosphatase, family IIIA (TIGR01668; EC 3.1.3.-; HMM-score: 166.3)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IIIA (TIGR01662; HMM-score: 81.4)
    HAD hydrolase, TIGR02253 family (TIGR02253; HMM-score: 40.4)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IIA (TIGR01460; HMM-score: 34.5)
    Unknown functionEnzymes of unknown specificityCof-like hydrolase (TIGR00099; HMM-score: 34.2)
    noncanonical pyrimidine nucleotidase, YjjG family (TIGR02254; EC 3.1.3.5; HMM-score: 31.3)
    phosphoglycolate/pyridoxal phosphate phosphatase family (TIGR01452; EC 3.1.3.18; HMM-score: 29.8)
    HAD hydrolase, REG-2-like, family IA (TIGR02252; HMM-score: 29)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IA, variant 1 (TIGR01549; HMM-score: 26.1)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, TIGR01457 family (TIGR01457; HMM-score: 23.6)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IA, variant 3 (TIGR01509; HMM-score: 23.4)
    histidinol-phosphate phosphatase domain (TIGR01656; HMM-score: 22.9)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, family IIB (TIGR01484; HMM-score: 22.2)
    HAD hydrolase, TIGR01459 family (TIGR01459; HMM-score: 22)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharides3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family (TIGR01670; EC 3.1.3.45; HMM-score: 21.4)
    Unknown functionEnzymes of unknown specificityHAD phosphoserine phosphatase-like hydrolase, family IB (TIGR01488; HMM-score: 21.2)
    Unknown functionEnzymes of unknown specificityHAD hydrolase, TIGR01458 family (TIGR01458; HMM-score: 21)
    HAD phosphatase, family IIIC (TIGR01681; HMM-score: 18.8)
    mannosyl-3-phosphoglycerate phosphatase family (TIGR01486; EC 3.1.3.-; HMM-score: 18.1)
    HAD hydrolase, family IA, variant 2 (TIGR01493; HMM-score: 15.9)
    FkbH domain (TIGR01686; HMM-score: 15.9)
    sucrose-phosphate phosphatase subfamily (TIGR01482; EC 3.1.3.-; HMM-score: 15)
    mannosyl-3-phosphoglycerate phosphatase (TIGR02461; EC 3.1.3.70; HMM-score: 14.8)
    beta-phosphoglucomutase family hydrolase (TIGR02009; HMM-score: 14.5)
    haloacid dehalogenase, type II (TIGR01428; EC 3.8.1.2; HMM-score: 13.8)
    pyrimidine 5'-nucleotidase (TIGR01993; EC 3.1.3.5; HMM-score: 13.5)
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharidesbeta-phosphoglucomutase (TIGR01990; EC 5.4.2.6; HMM-score: 12.1)
    sucrose phosphatase (TIGR01485; EC 3.1.3.24; HMM-score: 11.7)
  • TheSEED:  
    FIG001553: Hydrolase, HAD subfamily IIIA 
  • PFAM:
    HAD (CL0137) HAD_2; haloacid dehalogenase-like hydrolase (PF13419; HMM-score: 38.7)
    Hydrolase_like; HAD-hyrolase-like (PF13242; HMM-score: 35.2)
    Hydrolase_3; haloacid dehalogenase-like hydrolase (PF08282; HMM-score: 34)
    PGP_phosphatase; Mitochondrial PGP phosphatase (PF09419; HMM-score: 32.8)
    Hydrolase; haloacid dehalogenase-like hydrolase (PF00702; HMM-score: 26.1)
    Hydrolase_6; haloacid dehalogenase-like hydrolase (PF13344; HMM-score: 16.7)
    Glyco_hydro_tim (CL0058) Cellulase; Cellulase (glycosyl hydrolase family 5) (PF00150; HMM-score: 13.5)
    HAD (CL0137) S6PP; Sucrose-6F-phosphate phosphohydrolase (PF05116; HMM-score: 13.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.127
    • Ymax_pos: 17
    • Cmax: 0.144
    • Cmax_pos: 56
    • Smax: 0.203
    • Smax_pos: 16
    • Smean: 0.145
    • D: 0.134
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MGLVRKFFMPNSYVQSIFQIDLDKLVDKGVKGIITDLDNTLVGWDVKEPTERVKAWFKEANEKGITITIVSNNNESRVASFSQHLDIDFIFKARKPMGKAFDKAITKMNIRPDQTVVIGDQMLTDVFGGNRRGLYTIMVVPVKRTDGFITKFNRLIERRLLRHFSKKGYITWEEN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]