From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004184000
  • symbol?:
  • description?: HAD superfamily hydrolase

      descriptions from strain specific annotations:

    • HAD superfamily hydrolase
    • HAD family phosphatase
    • HAD hydrolase family protein
    • had superfamily (subfamily iiia) phosphatase
    • HAD superfamily phosphatase
    • haloacid dehalogenase-like hydrolase
    • Hydrolase, HAD subfamily IIIA
    • Hydrolase, HAD-superfamily, subfamily IIIA
    • hydrolase, HAD-superfamily, subfamily IIIA domain protein
    • lipase
  • strand?: -
  • coordinates?: 4445787..4446314
  • synteny block?: BlockID0032140
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1556
    08BA02176:
    C248_1640
    11819-97:
    MS7_1615
    71193:
    ST398NM01_1663
    ECT-R 2:
    ECTR2_1447
    ED133:
    SAOV_1597
    ED98:
    SAAV_1589
    HO 5096 0412:
    SAEMRSA15_15170
    JH1:
    SaurJH1_1690
    JH9:
    SaurJH9_1655
    JKD6008:
    SAA6008_01568
    JKD6159:
    SAA6159_01533
    LGA251:
    SARLGA251_15030
    M013:
    M013TW_1612
    MRSA252:
    SAR1675
    MSHR1132:
    SAMSHR1132_14370
    MSSA476:
    SAS1535
    Mu3:
    SAHV_1585
    Mu50:
    SAV1598
    MW2:
    MW1549
    RF122:
    SAB1470c
    ST398:
    SAPIG1663 (yqeG)
    T0131:
    SAT0131_01694
    TCH60:
    HMPREF0772_11543 (yqeG)
    TW20:
    SATW20_15940
    USA300_TCH1516:
    USA300HOU_1599
    VC40:
    SAVC_07245

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MGLVRKFFMPNSYVQSIFQIDLDKLVDKGVKGIITDLDNTLVGWDVKEPTERVKAWFKEA
    N315            MGLVRKFFMPNSYVQSIFQIDLDKLVDKGVKGIITDLDNTLVGWDVKEPTERVKAWFKEA
    NCTC8325        MGLVRKFFMPNSYVQSIFQIDLDKLVDKGVKGIITDLDNTLVGWDVKEPTERVKAWFKEA
    Newman          MGLVRKFFMPNSYVQSIFQIDLDKLVDKGVKGIITDLDNTLVGWDVKEPTERVKAWFKEA
    USA300_FPR3757  MGLVRKFFMPNSYVQSIFQIDLDKLVDKGVKGIITDLDNTLVGWDVKEPTERVKAWFKEA
                    ************************************************************

    COL             NEKGITITIVSNNNESRVASFSQHLDIDFIFKARKPMGKAFDKAITKMNIRPDQTVVIGD
    N315            NEKGITITIVSNNNESRVASFSQHLDIDFIFKARKPMGKAFDKAITKMNIRPDQTVVIGD
    NCTC8325        NEKGITITIVSNNNESRVASFSQHLDIDFIFKARKPMGKAFDKAITKMNIRPDQTVVIGD
    Newman          NEKGITITIVSNNNESRVASFSQHLDIDFIFKARKPMGKAFDKAITKMNIRPDQTVVIGD
    USA300_FPR3757  NEKGITITIVSNNNESRVASFSQHLDIDFIFKARKPMGKAFDKAITKMNIRPDQTVVIGD
                    ************************************************************

    COL             QMLTDVFGGNRRGLYTIMVVPVKRTDGFITKFNRLIERRLLRHFSKKGYITWEEN
    N315            QMLTDVFGGNRRGLYTIMVVPVKRTDGFITKVNRLIERRLLRHFSKKGYITWEEN
    NCTC8325        QMLTDVFGGNRRGLYTIMVVPVKRTDGFITKFNRLIERRLLRHFSKKGYITWEEN
    Newman          QMLTDVFGGNRRGLYTIMVVPVKRTDGFITKFNRLIERRLLRHFSKKGYITWEEN
    USA300_FPR3757  QMLTDVFGGNRRGLYTIMVVPVKRTDGFITKFNRLIERRLLRHFSKKGYITWEEN
                    *******************************.***********************