From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1595 [new locus tag: NWMN_RS08945 ]
  • pan locus tag?: SAUPAN004348000
  • symbol: accD
  • pan gene symbol?: accD
  • synonym:
  • product: acetyl-CoA carboxylase subunit beta

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1595 [new locus tag: NWMN_RS08945 ]
  • symbol: accD
  • product: acetyl-CoA carboxylase subunit beta
  • replicon: chromosome
  • strand: -
  • coordinates: 1768726..1769583
  • length: 858
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGTTTAAAGATTTTTTTAATCGAACAAAGAAAAAGAAATATCTTACAGTACAAGACTCT
    AAAAATAAAGATGTGCCTGCAGGTATTATGACTAAGTGTCCAAAGTGTAAGAAAATTATG
    TACACAAAAGAATTAGCTGAAAATTTAAATGTGTGCTTTAATTGTGATCATCATATTGCT
    TTAACTGCGTATAAACGTATAGAAGCAATTTCTGATGAAGGATCATTTACAGAATTCGAT
    AAGGGAATGACCTCTGCGAATCCATTAGATTTTCCAAGTTATTTAGAAAAAATTGAAAAG
    GACCAACAAAAGACAGGTCTTAAAGAAGCAGTTGTGACTGGTACAGCACAACTAGATGGT
    ATGAAATTTGGCGTTGCTGTCATGGATTCACGTTTTAGAATGGGAAGTATGGGATCGGTT
    ATCGGTGAAAAGATATGTCGCATCATTGATTACTGCACTGAGAACCGTTTACCATTTATT
    CTTTTCTCTGCAAGTGGTGGTGCACGTATGCAAGAAGGTATTATTTCCTTGATGCAAATG
    GGTAAAACCAGTGTATCTTTAAAACGTCATTCTGACGCTGGACTATTATATATATCATAT
    TTAACACATCCAACTACTGGTGGTGTATCTGCAAGTTTTGCATCAGTTGGTGATATAAAT
    TTAAGTGAGCCAAAAGCGTTGATAGGTTTTGCAGGTCGTCGAGTTATTGAACAGACAATA
    AACGAAAAATTGCCAGATGATTTCCAAACTGCAGAATTTTTATTAGAGCATGGACAATTG
    GATAAAGTTGTACATCGTAATGATATGCGTCAAACATTGTCTGAAATTCTAAAAATCCAT
    CAAGAGGTGACTAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    858

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1595 [new locus tag: NWMN_RS08945 ]
  • symbol: AccD
  • description: acetyl-CoA carboxylase subunit beta
  • length: 285
  • theoretical pI: 8.56512
  • theoretical MW: 31885.6
  • GRAVY: -0.303509

Function[edit source | edit]

  • reaction:
    EC 6.4.1.2?  ExPASy
    Acetyl-CoA carboxylaseATP + acetyl-CoA + HCO3(-) = ADP + phosphate + malonyl-CoA
  • TIGRFAM:
    MetabolismFatty acid and phospholipid metabolismBiosynthesisacetyl-CoA carboxylase, carboxyl transferase, beta subunit (TIGR00515; EC 6.4.1.2; HMM-score: 416.1)
    MetabolismTransport and binding proteinsCations and iron carrying compoundsmethylmalonyl-CoA decarboxylase alpha subunit (TIGR01117; EC 4.1.1.41; HMM-score: 52.4)
    MetabolismEnergy metabolismFermentationmethylmalonyl-CoA decarboxylase alpha subunit (TIGR01117; EC 4.1.1.41; HMM-score: 52.4)
    MetabolismEnergy metabolismATP-proton motive force interconversionmethylmalonyl-CoA decarboxylase alpha subunit (TIGR01117; EC 4.1.1.41; HMM-score: 52.4)
    biotin-independent malonate decarboxylase, beta subunit (TIGR03133; EC 4.1.1.88; HMM-score: 46.5)
  • TheSEED:  
    Fatty Acids, Lipids, and IsoprenoidsFatty acidsFatty Acid Biosynthesis FASII Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2) 
    Virulence, Disease and DefenseBacteriocins, ribosomally synthesized antibacterial peptidesColicin V and Bacteriocin Production Cluster Acetyl-coenzyme A carboxyl transferase beta chain (EC 6.4.1.2) 
  • PFAM:
    ClpP_crotonase (CL0127) Carboxyl_trans; Carboxyl transferase domain (PF01039; HMM-score: 66.9)
    AB_hydrolase (CL0028) FSH1; Serine hydrolase (FSH1) (PF03959; HMM-score: 12)
    Zn_Beta_Ribbon (CL0167) RNA_POL_M_15KD; RNA polymerases M/15 Kd subunit (PF02150; HMM-score: 9.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Zn2+
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.2
    • Ymax_pos: 11
    • Cmax: 0.11
    • Cmax_pos: 23
    • Smax: 0.573
    • Smax_pos: 1
    • Smean: 0.361
    • D: 0.263
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MFKDFFNRTKKKKYLTVQDSKNKDVPAGIMTKCPKCKKIMYTKELAENLNVCFNCDHHIALTAYKRIEAISDEGSFTEFDKGMTSANPLDFPSYLEKIEKDQQKTGLKEAVVTGTAQLDGMKFGVAVMDSRFRMGSMGSVIGEKICRIIDYCTENRLPFILFSASGGARMQEGIISLMQMGKTSVSLKRHSDAGLLYISYLTHPTTGGVSASFASVGDINLSEPKALIGFAGRRVIEQTINEKLPDDFQTAEFLLEHGQLDKVVHRNDMRQTLSEILKIHQEVTK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]