Due to technical reasons this service will not be available for 7 days from 27 Nov to 04 Dec 2017
From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004348000
  • symbol?: accD
  • description?: acetyl-CoA carboxylase subunit beta

      descriptions from strain specific annotations:

    • acetyl-CoA carboxylase subunit beta
    • Acetyl-coenzyme A carboxyl transferase beta chain
    • acetyl-CoA carboxylase, carboxyl transferase subunit beta
    • acetyl-coenzyme A carboxylase carboxyltransferase subunit beta
    • acetyl-coA carboxylase carboxyl transferase subunit beta
    • acetyl-CoA carboxylase, carboxyl transferase, beta subunit
  • strand?: -
  • coordinates?: 4587939..4588796
  • synteny block?: BlockID0033530
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1748 (accD)
    N315:
    NCTC8325:
    Newman:
    NWMN_1595 (accD)
    USA300_FPR3757:
    04-02981:
    SA2981_1659 (accB)
    08BA02176:
    C248_1742 (accD)
    11819-97:
    MS7_1707 (accD)
    71193:
    ST398NM01_1754
    ECT-R 2:
    ECTR2_1540 (accD)
    ED133:
    SAOV_1688 (accD)
    ED98:
    SAAV_1710 (accD)
    HO 5096 0412:
    SAEMRSA15_16100 (accD)
    JH1:
    SaurJH1_1791
    JH9:
    SaurJH9_1757
    JKD6008:
    SAA6008_01669 (accD)
    JKD6159:
    SAA6159_01624 (accD)
    LGA251:
    SARLGA251_15920 (accD)
    M013:
    M013TW_1713
    MRSA252:
    SAR1779 (accD)
    MSHR1132:
    SAMSHR1132_15510
    MSSA476:
    SAS1628
    Mu3:
    SAHV_1687
    Mu50:
    SAV1701
    MW2:
    MW1644
    RF122:
    SAB1559c (accD)
    ST398:
    SAPIG1754 (accD)
    T0131:
    SAT0131_01804
    TCH60:
    HMPREF0772_11451 (accD)
    TW20:
    SATW20_16920 (accD)
    USA300_TCH1516:
    USA300HOU_1687 (accD)
    VC40:
    SAVC_07715

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MFKDFFNRTKKKKYLTVQDSKNNDVPAGIMTKCPKCKKIMYTKELAENLNVCFNCDHHIA
    N315            MFKDFFNRTKKKKYLTVQDSKNNDVPAGIMTKCPKCKKIMYTKELAENLNVCFNCDHHIA
    NCTC8325        MFKDFFNRTKKKKYLTVQDSKNNDVPAGIMTKCPKCKKIMYTKELAENLNVCFNCDHHIA
    Newman          MFKDFFNRTKKKKYLTVQDSKNKDVPAGIMTKCPKCKKIMYTKELAENLNVCFNCDHHIA
    USA300_FPR3757  MFKDFFNRTKKKKYLTVQDSKNNDVPAGIMTKCPKCKKIMYTKELAENLNVCFNCDHHIA
                    **********************:*************************************

    COL             LTAYKRIEAISDEGSFTEFDKGMTSANPLDFPSYLEKIEKDQQKTGLKEAVVTGTAQLDG
    N315            LTAYKRIEAISDEGSFTEFDKGMTSANPLDFPSYLEKIEKDQQKTGLKEAVVTGTAQLDG
    NCTC8325        LTAYKRIEAISDEGSFTEFDKGMTSANPLDFPSYLEKIEKDQQKTGLKEAVVTGTAQLDG
    Newman          LTAYKRIEAISDEGSFTEFDKGMTSANPLDFPSYLEKIEKDQQKTGLKEAVVTGTAQLDG
    USA300_FPR3757  LTAYKRIEAISDEGSFTEFDKGMTSANPLDFPSYLEKIEKDQQKTGLKEAVVTGTAQLDG
                    ************************************************************

    COL             MKFGVAVMDSRFRMGSMGSVIGEKICRIIDYCTENRLPFILFSASGGARMQEGIISLMQM
    N315            MKFGVAVMDSRFRMGSMGSVIGEKICRIIDYCTENRLPFILFSASGGARMQEGIISLMQM
    NCTC8325        MKFGVAVMDSRFRMGSMGSVIGEKICRIIDYCTENRLPFILFSASGGARMQEGIISLMQM
    Newman          MKFGVAVMDSRFRMGSMGSVIGEKICRIIDYCTENRLPFILFSASGGARMQEGIISLMQM
    USA300_FPR3757  MKFGVAVMDSRFRMGSMGSVIGEKICRIIDYCTENRLPFILFSASGGARMQEGIISLMQM
                    ************************************************************

    COL             GKTSVSLKRHSDAGLLYISYLTHPTTGGVSASFASVGDINLSEPKALIGFAGRRVIEQTI
    N315            GKTSVSLKRHSDAGLLYISYLTHPTTGGVSASFASVGDINLSEPKALIGFAGRRVIEQTI
    NCTC8325        GKTSVSLKRHSDAGLLYISYLTHPTTGGVSASFASVGDINLSEPKALIGFAGRRVIEQTI
    Newman          GKTSVSLKRHSDAGLLYISYLTHPTTGGVSASFASVGDINLSEPKALIGFAGRRVIEQTI
    USA300_FPR3757  GKTSVSLKRHSDAGLLYISYLTHPTTGGVSASFASVGDINLSEPKALIGFAGRRVIEQTI
                    ************************************************************

    COL             NEKLPDDFQTAEFLLEHGQLDKVVHRNDMRQTLSEILKIHQEVTK
    N315            NEKLPDDFQTAEFLLEHGQLDKVVHRNDMRQTLSEILKIHQEVTK
    NCTC8325        NEKLPDDFQTAEFLLEHGQLDKVVHRNDMRQTLSEILKIHQEVTK
    Newman          NEKLPDDFQTAEFLLEHGQLDKVVHRNDMRQTLSEILKIHQEVTK
    USA300_FPR3757  NEKLPDDFQTAEFLLEHGQLDKVVHRNDMRQTLSEILKIHQEVTK
                    *********************************************