From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN003916000
  • symbol?: birA
  • description?: biotin ligase

      descriptions from strain specific annotations:

    • biotin ligase
    • biotin--acetyl-CoA-carboxylase ligase
    • birA bifunctional protein
    • Biotin-protein ligase / Biotin operon repressor
    • biotin-[acetyl-CoA-carboxylase] ligase
    • bifunctional biotin--[acetyl-CoA-carboxylase] ligase/biotin operon transcriptional regulator
    • BirA bifunctional protein [includes: biotinoperon repressor
    • biotin--[acetyl-CoA-carboxylase]synthetase
    • bifunctional biotin-(acetyl-CoA carboxylase) ligase / biotin operon repressor
    • bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor
    • BirA bifunctional protein [includes: biotin operon repressor]
    • bifunctional biotin operon-related protein and biotin-acetyl-CoA-carboxylase
    • BirA family transcriptional regulator
    • BirA bifunctional biotin operon repressor/biotin--[acetyl-CoA-carboxylase] synthetase
  • strand?: -
  • coordinates?: 4236746..4237717
  • synteny block?: BlockID0029620
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1496 (birA)
    N315:
    NCTC8325:
    Newman:
    NWMN_1367 (birA)
    USA300_FPR3757:
    04-02981:
    SA2981_1412
    08BA02176:
    C248_1496 (birA)
    11819-97:
    MS7_1412
    71193:
    ST398NM01_1456
    ECT-R 2:
    ECTR2_1310
    ED133:
    SAOV_1464 (birA)
    ED98:
    SAAV_1443 (birA)
    HO 5096 0412:
    SAEMRSA15_13170 (birA)
    JH1:
    SaurJH1_1544
    JH9:
    SaurJH9_1515
    JKD6008:
    SAA6008_01425 (birA)
    JKD6159:
    SAA6159_01321 (birA)
    LGA251:
    SARLGA251_13700 (birA)
    M013:
    M013TW_1404
    MRSA252:
    SAR1467 (birA)
    MSHR1132:
    SAMSHR1132_12960
    MSSA476:
    SAS1399
    Mu3:
    SAHV_1444
    Mu50:
    SAV1456
    MW2:
    MW1346
    RF122:
    SAB1320c (birA)
    ST398:
    SAPIG1456
    T0131:
    SAT0131_01545
    TCH60:
    HMPREF0772_11748 (birA)
    TW20:
    SATW20_14550 (birA)
    USA300_TCH1516:
    USA300HOU_1394 (birA)
    VC40:
    SAVC_06535

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MSKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLL
    N315            MSKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLL
    NCTC8325        MSKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLL
    Newman          MSKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLL
    USA300_FPR3757  MSKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLL
                    ************************************************************

    COL             QQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGR
    N315            QQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGR
    NCTC8325        QQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGR
    Newman          QQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGR
    USA300_FPR3757  QQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGR
                    ************************************************************

    COL             GRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPND
    N315            GRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPND
    NCTC8325        GRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPND
    Newman          GRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPND
    USA300_FPR3757  GRFNRHWSSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPND
                    ************************************************************

    COL             IYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLD
    N315            IYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLD
    NCTC8325        IFIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLD
    Newman          IYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLD
    USA300_FPR3757  IYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLD
                    *:**********************************************************

    COL             RYQFLEILLQEIEKRYNQFLTLPFSEIREEYTAASNIWNRTLLFTENDKQFKGQAIDLDY
    N315            RYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDY
    NCTC8325        RYQFLEILLQEIEKRYNQFLTLPFSEIREEYTAASNIWNRTLLFTENDKQFKGQAIDLDY
    Newman          RYQFLEILLQEIEKRYNQFLTLPFSEIREEYTAASNIWNRTLLFTENDKQFKGQAIDLDY
    USA300_FPR3757  RYQFLEILLQEIEKRYNQFLTLPFSEIREEYTAASNIWNRTLLFTENDKQFKGQAIDLDY
                    ****** ************************ ****************************

    COL             DGYLIVRDEAGESHRLISADIDF
    N315            DGYLIVRDEAGESHRLISADIDF
    NCTC8325        DGYLIVRDEAGESHRLISADIDF
    Newman          DGYLIVRDEAGESHRLISADIDF
    USA300_FPR3757  DGYLIVRDEAGESHRLISADIDF
                    ***********************