From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004081000
  • symbol?: accC
  • description?: acetyl-CoA carboxylase biotin carboxylase subunit

      descriptions from strain specific annotations:

    • acetyl-CoA carboxylase biotin carboxylase subunit
    • Biotin carboxylase of acetyl-CoA carboxylase
    • acetyl-CoA carboxylase, biotin carboxylase
    • acetyl-CoA carboxylase, biotin carboxylase subunit
    • biotin carboxylase subunit of acetyl-CoAcarboxylase
    • acetyl-CoA carboxylase accC (biotin carboxylase subunit)
  • strand?: -
  • coordinates?: 4361868..4363226
  • synteny block?: BlockID0031130
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1571 (accC)
    N315:
    SA1357 (accC)
    NCTC8325:
    Newman:
    NWMN_1431 (accC)
    USA300_FPR3757:
    04-02981:
    SA2981_1485 (accC)
    08BA02176:
    C248_1569 (accC)
    11819-97:
    MS7_1544 (accC)
    71193:
    ST398NM01_1592
    ECT-R 2:
    ECTR2_1378 (accC)
    ED133:
    SAOV_1527
    ED98:
    SAAV_1519 (accC)
    HO 5096 0412:
    SAEMRSA15_14470 (accC)
    JH1:
    SaurJH1_1618
    JH9:
    SaurJH9_1585
    JKD6008:
    SAA6008_01496 (accC)
    JKD6159:
    SAA6159_01462 (accC)
    LGA251:
    SARLGA251_14330 (accC)
    M013:
    M013TW_1542
    MRSA252:
    SAR1604 (accC)
    MSHR1132:
    SAMSHR1132_13670
    MSSA476:
    SAS1465
    Mu3:
    SAHV_1514 (accC)
    Mu50:
    SAV1526 (accC)
    MW2:
    MW1479 (accC)
    RF122:
    SAB1399c (accC)
    ST398:
    SAPIG1592 (accC)
    T0131:
    SAT0131_01620
    TCH60:
    HMPREF0772_11614 (accC2)
    TW20:
    SATW20_15230 (accC)
    USA300_TCH1516:
    USA300HOU_1528 (accC)
    VC40:
    SAVC_06880

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKVLIANRGEIAVRIIRACRDLGIQTVAIYSEGDKDALHTQIADEAYCVGPTLSKDSYL
    N315            MKKVLIANRGEIAVRIIRACRDLGIQTVAIYSEGDKDALHTQIADEAYCVGPTLSKDSYL
    NCTC8325        MKKVLIANRGEIAVRIIRACRDLGIQTVAIYSEGDKDALHTQIADEAYCVGPTLSKDSYL
    Newman          MKKVLIANRGEIAVRIIRACRDLGIQTVAIYSEGDKDALHTQIADEAYCVGPTLSKDSYL
    USA300_FPR3757  MKKVLIANRGEIAVRIIRACRDLGIQTVAIYSEGDKDALHTQIADEAYCVGPTLSKDSYL
                    ************************************************************

    COL             NIPNILSIATSTGCDGVHPGYGFLAENADFAELCEACQLKFIGPSYQSIQKMGIKDVAKA
    N315            NIPNILSIATSTGCDGVHPGYGFLAENADFAELCEACQLKFIGPSYQSIQKMGIKDVAKA
    NCTC8325        NIPNILSIATSTGCDGVHPGYGFLAENADFAELCEACQLKFIGPSYQSIQKMGIKDVAKA
    Newman          NIPNILSIATSTGCDGVHPGYGFLAENADFAELCEACQLKFIGPSYQSIQKMGIKDVAKA
    USA300_FPR3757  NIPNILSIATSTGCDGVHPGYGFLAENADFAELCEACQLKFIGPSYQSIQKMGIKDVAKA
                    ************************************************************

    COL             EMIKANVPVVPGSDGLMKDVSEAKKIAKKIGYPVIIKATAGGGGKGIRVARDEKELETGF
    N315            EMIKANVPVVPGSDGLMKDVSEAKKIAKKIGYPVIIKATAGGGGKGIRVARDEKELETGF
    NCTC8325        EMIKANVPVVPGSDGLMKDVSEAKKIAKKIGYPVIIKATAGGGGKGIRVARDEKELETGF
    Newman          EMIKANVPVVPGSDGLMKDVSEAKKIAKKIGYPVIIKATAGGGGKGIRVARDEKELETGF
    USA300_FPR3757  EMIKANVPVVPGSDGLMKDVSEAKKIAKKIGYPVIIKATAGGGGKGIRVARDEKELETGF
                    ************************************************************

    COL             RMTEQEAQTAFGNGGLYMEKFIENFRHIEIQIVGDSYGNVIHLGERDCTIQRRMQKLVEE
    N315            RMTEQEAQTAFGNGGLYMEKFIENFRHIEIQIVGDSYGNVIHLGERDCTIQRRMQKLVEE
    NCTC8325        RMTEQEAQTAFGNGGLYMEKFIENFRHIEIQIVGDSYGNVIHLGERDCTIQRRMQKLVEE
    Newman          RMTEQEAQTAFGNGGLYMEKFIENFRHIEIQIVGDSYGNVIHLGERDCTIQRRMQKLVEE
    USA300_FPR3757  RMTEQEAQTAFGNGGLYMEKFIENFRHIEIQIVGDSYGNVIHLGERDCTIQRRMQKLVEE
                    ************************************************************

    COL             APSPILDDETRREMGNAAVRAAKAVNYENAGTIEFIYDLNDNKFYFMEMNTRIQVEHPVT
    N315            APSPILDDETRREMGNAAVRAAKAVNYENAGTIEFIYDLNDNKFYFMEMNTRIQVEHPVT
    NCTC8325        APSPILDDETRREMGNAAVRAAKAVNYENAGTIEFIYDLNDNKFYFMEMNTRIQVEHPVT
    Newman          APSPILDDETRREMGNAAVRAAKAVNYENAGTIEFIYDLNDNKFYFMEMNTRIQVEHPVT
    USA300_FPR3757  APSPILDDETRREMGNAAVRAAKAVNYENAGTIEFIYDLNDNKFYFMEMNTRIQVEHPVT
                    ************************************************************

    COL             EMVTGIDLVKLQLQVAMGDVLPYKQEDIKLTGHAIEFRINAENPYKNFMPSPGKIEQYLA
    N315            EMVTGIDLVKLQLQVAMGDVLPYKQEDIKLTGHAIEFRINAENPYKNFMPSPGKIEQYLA
    NCTC8325        EMVTGIDLVKLQLQVAMGDVLPYKQEDIKLTGHAIEFRINAENPYKNFMPSPGKIEQYLA
    Newman          EMVTGIDLVKLQLQVAMGDVLPYKQEDIKLTGHAIEFRINAENPYKNFMPSPGKIEQYLA
    USA300_FPR3757  EMVTGIDLVKLQLQVAMGDVLPYKQEDIKLTGHAIEFRINAENPYKNFMPSPGKIEQYLA
                    ************************************************************

    COL             PGGYGVRIESACYTNYTIPPYYDSMVAKLIIHEPTRDEAIMAGIRALSEFVVLGIDTTIP
    N315            PGGYGVRIESACYTNYTIPPYYDSMVAKLIIHEPTRDEAIMAGIRALSEFVVLGIDTTIP
    NCTC8325        PGGYGVRIESACYTNYTIPPYYDSMVAKLIIHEPTRDEAIMAGIRALSEFVVLGIDTTIP
    Newman          PGGYGVRIESACYTNYTIPPYYDSMVAKLIIHEPTRDEAIMAGIRALSEFVVLGIDTTIP
    USA300_FPR3757  PGGYGVRIESACYTNYTIPPYYDSMVAKLIIHEPTRDEAIMAGIRALSEFVVLGIDTTIP
                    ************************************************************

    COL             FHIKLLNNDIFRSGKFNTNFLEQNSIMNDEG
    N315            FHIKLLNNDIFRSGKFNTNFLEQNSIMNDEG
    NCTC8325        FHIKLLNNDIFRSGKFNTNFLEQNSIMNDEG
    Newman          FHIKLLNNDIFRSGKFNTNFLEQNSIMNDEG
    USA300_FPR3757  FHIKLLNNDIFRSGKFNTNFLEQNSIMNDEG
                    *******************************