From AureoWiki
Jump to: navigation, search
NCBI: 03-AUG-2016

Summary[edit source | edit]

  • organism: Staphylococcus aureus NCTC8325
  • locus tag: SAOUHSC_01623
  • pan locus tag?: SAUPAN004081000
  • symbol: SAOUHSC_01623
  • pan gene symbol?: accC
  • synonym:
  • product: acetyl-CoA carboxylase biotin carboxylase subunit

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: SAOUHSC_01623
  • symbol: SAOUHSC_01623
  • product: acetyl-CoA carboxylase biotin carboxylase subunit
  • replicon: chromosome
  • strand: -
  • coordinates: 1545328..1546683
  • length: 1356
  • essential: yes [1] DEG other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    1141
    1201
    1261
    1321
    ATGAAAAAGGTTTTAATTGCAAACCGCGGTGAAATCGCAGTTAGGATTATTCGCGCTTGT
    CGTGATTTAGGCATCCAAACTGTTGCAATCTATTCTGAAGGGGATAAAGATGCGCTACAT
    ACTCAAATTGCTGATGAAGCATATTGCGTAGGTCCCACTTTGTCTAAAGATTCATATTTA
    AATATTCCGAACATCTTATCTATTGCAACTTCTACAGGTTGTGATGGCGTTCATCCGGGT
    TATGGCTTTTTAGCTGAAAATGCTGATTTTGCAGAATTATGCGAAGCATGCCAATTGAAG
    TTCATTGGACCAAGTTATCAATCTATCCAAAAAATGGGTATCAAAGATGTTGCTAAGGCA
    GAAATGATCAAAGCCAATGTTCCAGTTGTTCCTGGTAGTGACGGTTTAATGAAAGACGTC
    TCAGAAGCTAAGAAAATCGCCAAAAAAATTGGCTATCCGGTCATCATTAAAGCTACTGCT
    GGCGGTGGCGGAAAAGGTATCCGTGTTGCTCGTGATGAAAAAGAACTTGAAACTGGCTTC
    CGAATGACAGAACAAGAAGCTCAAACTGCATTTGGTAATGGTGGACTTTATATGGAGAAA
    TTCATCGAAAACTTCCGCCATATTGAAATCCAAATTGTTGGGGACAGCTATGGTAATGTA
    ATTCATTTAGGAGAACGTGATTGTACAATTCAAAGACGTATGCAGAAATTAGTGGAAGAA
    GCACCTTCCCCAATTTTAGATGATGAAACACGTCGTGAAATGGGAAATGCCGCAGTTCGT
    GCAGCGAAAGCTGTAAATTATGAAAATGCGGGAACAATTGAGTTTATATATGATTTAAAT
    GATAATAAATTTTATTTTATGGAAATGAATACACGTATTCAAGTAGAACATCCTGTAACT
    GAAATGGTAACAGGAATTGATTTAGTTAAATTACAATTACAAGTTGCTATGGGTGACGTG
    TTACCGTATAAACAAGAAGATATTAAATTAACAGGACACGCAATTGAATTTAGAATTAAT
    GCTGAAAATCCTTACAAGAACTTTATGCCATCACCAGGTAAAATTGAGCAATATCTTGCA
    CCAGGTGGATATGGTGTTCGAATAGAGTCAGCATGTTATACTAATTATACGATACCGCCA
    TATTATGATTCGATGGTAGCGAAATTAATCATACATGAACCGACACGAGATGAAGCGATT
    ATGGCTGGCATTCGTGCACTAAGTGAATTTGTGGTTCTTGGTATTGATACAACTATTCCA
    TTCCATATTAAATTATTGAATAACGATATATTTAGAAGCGGTAAATTTAATACAAACTTT
    TTAGAGCAAAATAGCATTATGAATGATGAAGGTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1140
    1200
    1260
    1320
    1356

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: SAOUHSC_01623
  • symbol: SAOUHSC_01623
  • description: acetyl-CoA carboxylase biotin carboxylase subunit
  • length: 451
  • theoretical pI: 5.14581
  • theoretical MW: 50049
  • GRAVY: -0.211308

Function[edit source | edit]

  • reaction:
    EC 6.4.1.2?  ExPASy
    Acetyl-CoA carboxylaseATP + acetyl-CoA + HCO3(-) = ADP + phosphate + malonyl-CoA
  • TIGRFAM:
    MetabolismFatty acid and phospholipid metabolismBiosynthesisacetyl-CoA carboxylase, biotin carboxylase subunit (TIGR00514; EC 6.3.4.14; HMM-score: 738.1)
    MetabolismEnergy metabolismGlycolysis/gluconeogenesispyruvate carboxylase (TIGR01235; EC 6.4.1.1; HMM-score: 551.1)
    MetabolismCentral intermediary metabolismNitrogen metabolismurea carboxylase (TIGR02712; EC 6.3.4.6; HMM-score: 535.8)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPyrimidine ribonucleotide biosynthesiscarbamoyl-phosphate synthase, large subunit (TIGR01369; EC 6.3.5.5; HMM-score: 64)
    alpha-L-glutamate ligase, RimK family (TIGR00768; EC 6.3.2.-; HMM-score: 43.6)
    Cell structureCell envelopeBiosynthesis and degradation of murein sacculus and peptidoglycanD-alanine--D-alanine ligase (TIGR01205; EC 6.3.2.4; HMM-score: 41.9)
    lysine biosynthesis enzyme LysX (TIGR02144; HMM-score: 38.6)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisphosphoribosylglycinamide formyltransferase 2 (TIGR01142; EC 2.1.2.-; HMM-score: 29)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisphosphoribosylaminoimidazole carboxylase, ATPase subunit (TIGR01161; EC 4.1.1.21; HMM-score: 26.3)
    Cellular processesCellular processesBiosynthesis of natural productscyanophycin synthetase (TIGR02068; EC 6.3.2.29,6.3.2.30; HMM-score: 26)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisphosphoribosylamine--glycine ligase (TIGR00877; EC 6.3.4.13; HMM-score: 20.6)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOthercoenzyme gamma-F420-2:alpha-L-glutamate ligase (TIGR04443; EC 6.3.2.32; HMM-score: 12.9)
  • TheSEED:  
    Fatty Acids, Lipids, and IsoprenoidsFatty acidsFatty Acid Biosynthesis FASII Biotin carboxylase of acetyl-CoA carboxylase (EC 6.3.4.14) 
    MiscellaneousMiscellaneous - no subcategoryEC 6.3.4.- Ligases that form carbon-nitrogen bonds Biotin carboxylase of acetyl-CoA carboxylase (EC 6.3.4.14) 
  • PFAM:
    ATP-grasp (CL0179) CPSase_L_D2; Carbamoyl-phosphate synthase L chain, ATP binding domain (PF02786; HMM-score: 273.9)
    PreATP-grasp (CL0483) Biotin_carb_N; Biotin carboxylase, N-terminal domain (PF00289; HMM-score: 152.3)
    Hybrid (CL0105) Biotin_carb_C; Biotin carboxylase C-terminal domain (PF02785; HMM-score: 127.9)
    ATP-grasp (CL0179) ATPgrasp_Ter; ATP-grasp in the biosynthetic pathway with Ter operon (PF15632; HMM-score: 39.6)
    Dala_Dala_lig_C; D-ala D-ala ligase C-terminus (PF07478; HMM-score: 34.4)
    ATP-grasp; ATP-grasp domain (PF02222; HMM-score: 31.3)
    ATP-grasp_3; ATP-grasp domain (PF02655; HMM-score: 26.4)
    RimK; RimK-like ATP-grasp domain (PF08443; HMM-score: 24.9)
    GARS_A; Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain (PF01071; HMM-score: 14.8)
    ATPgrasp_ST; Sugar-transfer associated ATP-grasp (PF14397; HMM-score: 14.3)
    Chelatase (CL0043) Oxidored_nitro; Nitrogenase component 1 type Oxidoreductase (PF00148; HMM-score: 13.8)
    ATP-grasp (CL0179) ATP-grasp_4; ATP-grasp domain (PF13535; HMM-score: 12.2)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.145
    • Ymax_pos: 22
    • Cmax: 0.133
    • Cmax_pos: 32
    • Smax: 0.306
    • Smax_pos: 12
    • Smean: 0.203
    • D: 0.168
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKVLIANRGEIAVRIIRACRDLGIQTVAIYSEGDKDALHTQIADEAYCVGPTLSKDSYLNIPNILSIATSTGCDGVHPGYGFLAENADFAELCEACQLKFIGPSYQSIQKMGIKDVAKAEMIKANVPVVPGSDGLMKDVSEAKKIAKKIGYPVIIKATAGGGGKGIRVARDEKELETGFRMTEQEAQTAFGNGGLYMEKFIENFRHIEIQIVGDSYGNVIHLGERDCTIQRRMQKLVEEAPSPILDDETRREMGNAAVRAAKAVNYENAGTIEFIYDLNDNKFYFMEMNTRIQVEHPVTEMVTGIDLVKLQLQVAMGDVLPYKQEDIKLTGHAIEFRINAENPYKNFMPSPGKIEQYLAPGGYGVRIESACYTNYTIPPYYDSMVAKLIIHEPTRDEAIMAGIRALSEFVVLGIDTTIPFHIKLLNNDIFRSGKFNTNFLEQNSIMNDEG

Experimental data[edit source | edit]

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Roy R Chaudhuri, Andrew G Allen, Paul J Owen, Gil Shalom, Karl Stone, Marcus Harrison, Timothy A Burgis, Michael Lockyer, Jorge Garcia-Lara, Simon J Foster, Stephen J Pleasance, Sarah E Peters, Duncan J Maskell, Ian G Charles
    Comprehensive identification of essential Staphylococcus aureus genes using Transposon-Mediated Differential Hybridisation (TMDH).
    BMC Genomics: 2009, 10;291
    [PubMed:19570206] [WorldCat.org] [DOI] (I e)
  2. Maren Depke, Stephan Michalik, Alexander Rabe, Kristin Surmann, Lars Brinkmann, Nico Jehmlich, Jörg Bernhardt, Michael Hecker, Bernd Wollscheid, Zhi Sun, Robert L Moritz, Uwe Völker, Frank Schmidt
    A peptide resource for the analysis of Staphylococcus aureus in host-pathogen interaction studies.
    Proteomics: 2015, 15(21);3648-3661
    [PubMed:26224020] [WorldCat.org] [DOI] (I p)
  3. Ulrike Mäder, Pierre Nicolas, Maren Depke, Jan Pané-Farré, Michel Debarbouille, Magdalena M van der Kooi-Pol, Cyprien Guérin, Sandra Dérozier, Aurelia Hiron, Hanne Jarmer, Aurélie Leduc, Stephan Michalik, Ewoud Reilman, Marc Schaffer, Frank Schmidt, Philippe Bessières, Philippe Noirot, Michael Hecker, Tarek Msadek, Uwe Völker, Jan Maarten van Dijl
    Staphylococcus aureus Transcriptome Architecture: From Laboratory to Infection-Mimicking Conditions.
    PLoS Genet.: 2016, 12(4);e1005962
    [PubMed:27035918] [WorldCat.org] [DOI] (I e)

Relevant publications[edit source | edit]