From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1640 [new locus tag: NWMN_RS09210 ]
  • pan locus tag?: SAUPAN004414000
  • symbol: NWMN_1640
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1640 [new locus tag: NWMN_RS09210 ]
  • symbol: NWMN_1640
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1827361..1828203
  • length: 843
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    ATGAAAATCGGGGATATATCTATTCATTATCTAAATGGTGGCAATACAAAAATGGATGGC
    GGTGCAATGTTTGGTGTTGTTCCGAAGCCGTTGTGGTCAAAGCAATACAATGCAAATGAA
    CGAAATCAAATCAATTTACCGACACATCCAATTTTGATTCAAACGGCTCAATATAATTTG
    ATTATAGATGCAGGTATTGGTAATGGTAAATTATCTGAAAAGCAATTACGTAATTTTGGA
    GTAGATGAAGAAAGTCATATAATTGCTGATTTGGCAAATTATAATTTAACGCCAAAGGAT
    ATTGATTATGTGCTAATGACACATATGCATTTTGATCATGCTGCCGGTTTGACTGATCAA
    GCAGGACATGCAATTTTTGAAAATGCGATTCATGTTGTGCAACAAGATGAGTGGCATGAG
    TTTATTGCACCTAATATAAGAAGTAAATCAACTTACTGGGATAAGAATAAAGGCGATTAT
    AGTAACAAGTTGATTTTATTCGAAAAACATTTTGAACCGGTTCTGGGTATCAAGATGCAA
    CATAGTGGAGGTCATAGCTTTGGCCACACGATTATTACGATTGAAAGTCAAGGAGATAAA
    GCAGTTCATATGGGTGATATATTCCCAACTACTGCACATAAAAATCCTCTATGGGTAACG
    GCATATGATGATTATCCTATGCAATCGATTCGTGAAAAAGAACGCATGATACCATATTTT
    ATTCAGCAACAATATTGGTTCTTGTTTTATCATGATGAAAACTACTTTGCTGTAAAATAC
    AGCGATAATGGTGAAAACATAGATGCATATATTTTACGTGAAACATTAGTTGATAATAAC
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    843

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1640 [new locus tag: NWMN_RS09210 ]
  • symbol: NWMN_1640
  • description: hypothetical protein
  • length: 280
  • theoretical pI: 6.06469
  • theoretical MW: 32189
  • GRAVY: -0.491429

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingTranscriptionRNA processingribonuclease Z (TIGR02651; EC 3.1.26.11; HMM-score: 19.7)
    Unknown functionEnzymes of unknown specificityquinoprotein relay system zinc metallohydrolase 2 (TIGR04559; EC 3.-.-.-; HMM-score: 17.1)
    phosphonate metabolism protein PhnP (TIGR03307; HMM-score: 12.8)
    arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein (TIGR03675; HMM-score: 12.8)
  • TheSEED:  
    Metallo-beta-lactamase family protein 
  • PFAM:
    Metallo-HOrase (CL0381) Lactamase_B; Metallo-beta-lactamase superfamily (PF00753; HMM-score: 55.1)
    Lactamase_B_2; Beta-lactamase superfamily domain (PF12706; HMM-score: 22.2)
    Lactamase_B_3; Beta-lactamase superfamily domain (PF13483; HMM-score: 21.8)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.135
    • Ymax_pos: 39
    • Cmax: 0.132
    • Cmax_pos: 23
    • Smax: 0.231
    • Smax_pos: 31
    • Smean: 0.124
    • D: 0.131
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKIGDISIHYLNGGNTKMDGGAMFGVVPKPLWSKQYNANERNQINLPTHPILIQTAQYNLIIDAGIGNGKLSEKQLRNFGVDEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQAGHAIFENAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPVLGIKMQHSGGHSFGHTIITIESQGDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKERMIPYFIQQQYWFLFYHDENYFAVKYSDNGENIDAYILRETLVDNN

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]