From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004414000
  • symbol?:
  • description?: MBL fold metallo-hydrolase

      descriptions from strain specific annotations:

    • MBL fold metallo-hydrolase
    • metallo-beta-lactamase
    • metal-dependent hydrolase
    • beta-lactamase domain-containing protein
    • metallo-beta-lactamase family protein
    • metallo-beta-lactamase superfamily protein
  • strand?: -
  • coordinates?: 4661540..4662114
  • synteny block?: BlockID0034180
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1705
    08BA02176:
    C248_1792
    11819-97:
    MS7_1753
    71193:
    ST398NM01_1800
    ECT-R 2:
    ECTR2_1587
    ED133:
    SAOV_1733
    ED98:
    SAAV_1757
    HO 5096 0412:
    SAEMRSA15_16550
    JH1:
    SaurJH1_1837
    JH9:
    SaurJH9_1802
    JKD6008:
    SAA6008_01718
    JKD6159:
    SAA6159_01670
    LGA251:
    SARLGA251_16370
    M013:
    M013TW_1761
    MRSA252:
    SAR1825
    MSHR1132:
    SAMSHR1132_15970
    MSSA476:
    SAS1673
    Mu3:
    SAHV_1733
    Mu50:
    SAV1747
    MW2:
    MW1690
    RF122:
    SAB1607c
    ST398:
    SAPIG1800
    T0131:
    SAT0131_01855
    TCH60:
    HMPREF0772_11406
    TW20:
    SATW20_17370
    USA300_TCH1516:
    USA300HOU_1737
    VC40:
    SAVC_07945

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ----------------------MFGVVPKPLWSKQYNANERNQINLPTHPILIQTAQYNL
    N315            MKIGDISIHYLNGGNTKMDGGAMFGVVPKPLWSKQYNANERNQINLPTHPILIQTAQYNL
    NCTC8325        MKIGDISIHYLNGGNTKMDGGAMFGVVPKPLWSKQYNANERNQINLPTHPILIQTAQYNL
    Newman          MKIGDISIHYLNGGNTKMDGGAMFGVVPKPLWSKQYNANERNQINLPTHPILIQTAQYNL
    USA300_FPR3757  MKIGDISIHYLNGGNTKMDGGAMFGVVPKPLWSKQYNANERNQINLPTHPILIQTAQYNL
                                          **************************************

    COL             IIDAGIGNGKLSEKQLRNFGVDEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQ
    N315            IIDAGIGNGKLSEKQLRNFGVDEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQ
    NCTC8325        IIDAGIGNGKLSEKQLRNFGVDEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQ
    Newman          IIDAGIGNGKLSEKQLRNFGVDEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQ
    USA300_FPR3757  IIDAGIGNGKLSEKQLRNFGVDEESHIIADLANYNLTPKDIDYVLMTHMHFDHAAGLTDQ
                    ************************************************************

    COL             AGHAIFENAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPVLGIKMQ
    N315            AGHAIFENAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPVPGIKMQ
    NCTC8325        AGHAIFENAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPVLGIKMQ
    Newman          AGHAIFENAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPVLGIKMQ
    USA300_FPR3757  AGHAIFENAIHVVQQDEWHEFIAPNIRSKSTYWDKNKGDYSNKLILFEKHFEPVLGIKMQ
                    ****************************************************** *****

    COL             HSGGHSFGHTIITIESQGDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKERMIPYF
    N315            HSGGHSFGHTIITIESQGDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKERMIPYF
    NCTC8325        HSGGHSFGHTIITIESQGDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKERMIPYF
    Newman          HSGGHSFGHTIITIESQGDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKERMIPYF
    USA300_FPR3757  HSGGHSFGHTIITIESQGDKAVHMGDIFPTTAHKNPLWVTAYDDYPMQSIREKERMIPYF
                    ************************************************************

    COL             IQQQYWFLFYHDENYFAVKYSDNGENIDAYILRETLVDNN
    N315            IQQQYWFLFYHDENYFAVKYSDDGENIDAYILRETLVDNN
    NCTC8325        IQQQYWFLFYHDENYFAVKYSDNGENIDAYILRETLVDNN
    Newman          IQQQYWFLFYHDENYFAVKYSDNGENIDAYILRETLVDNN
    USA300_FPR3757  IQQQYWFLFYHDENYFAVKYSDNGENIDAYILRETLVDNN
                    **********************:*****************