From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1755 [new locus tag: NWMN_RS10035 ]
  • pan locus tag?: SAUPAN004843000
  • symbol: NWMN_1755
  • pan gene symbol?:
  • synonym:
  • product: bacterioferritin comigratory protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1755 [new locus tag: NWMN_RS10035 ]
  • symbol: NWMN_1755
  • product: bacterioferritin comigratory protein
  • replicon: chromosome
  • strand: -
  • coordinates: 1965454..1965909
  • length: 456
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGTTGCAAAAAGGAGAACAATTTCCAATATTTAAATTAGAAAATCAAGACGGAACTGTC
    ATTACAAATGATATATTAAAAGGTAAAAAGGCGATTATATATTTTTATCCTAGAGATAAT
    ACACCTACTTGTACCACAGAAGCTTGTGACTTTAGAGACAATTTAGAAATGTTCAATGAT
    TTAGATGTTGCAGTATATGGTATAAGCGGTGATTCAAAGAAAAAACACCAAAATTTTATT
    GAGAAACACGGATTGAATTTCGATTTATTAGTAGATGAAGATTTTAAATTAGCTAAAGAA
    ACTGGCGTATATCAGTTAAAAAAATCATTTGGCAAAGAAAGTATGGGCATTGTAAGAACG
    ACTTTTATAATAGATGAACAAGGTAAAGTATTAGATGTTATCGAGAAGGTTAAGGTTAAA
    ACACAAATAGAAGAACTTAAAAACATTTTGGGGTGA
    60
    120
    180
    240
    300
    360
    420
    456

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1755 [new locus tag: NWMN_RS10035 ]
  • symbol: NWMN_1755
  • description: bacterioferritin comigratory protein
  • length: 151
  • theoretical pI: 5.33808
  • theoretical MW: 17271.7
  • GRAVY: -0.415894

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesDetoxificationperoxiredoxin (TIGR03137; EC 1.11.1.15; HMM-score: 58.7)
    Cellular processesCellular processesAdaptations to atypical conditionsperoxiredoxin (TIGR03137; EC 1.11.1.15; HMM-score: 58.7)
  • TheSEED:  
    Sulfur MetabolismSulfur Metabolism - no subcategoryThioredoxin-disulfide reductase Thiol peroxidase, Bcp-type (EC 1.11.1.15) 
  • PFAM:
    Thioredoxin (CL0172) AhpC-TSA; AhpC/TSA family (PF00578; HMM-score: 120.7)
    Redoxin; Redoxin (PF08534; HMM-score: 79.4)
    AhpC-TSA_2; AhpC/TSA antioxidant enzyme (PF13911; HMM-score: 20)
    SCO1-SenC; SCO1/SenC (PF02630; HMM-score: 18)
    DUF899; Bacterial protein of unknown function (DUF899) (PF05988; HMM-score: 12)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cellwall
    • Cytoplasmic Score: 0.11
    • Cytoplasmic Membrane Score: 0.93
    • Cellwall Score: 8.19
    • Extracellular Score: 0.77
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.104
    • Ymax_pos: 11
    • Cmax: 0.112
    • Cmax_pos: 49
    • Smax: 0.131
    • Smax_pos: 2
    • Smean: 0.109
    • D: 0.106
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MLQKGEQFPIFKLENQDGTVITNDILKGKKAIIYFYPRDNTPTCTTEACDFRDNLEMFNDLDVAVYGISGDSKKKHQNFIEKHGLNFDLLVDEDFKLAKETGVYQLKKSFGKESMGIVRTTFIIDEQGKVLDVIEKVKVKTQIEELKNILG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator: NWMN_1753 (PerR*)
    PerR* (TF) important in Oxidative stress responseRegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]