From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004843000
  • symbol?:
  • description?: peroxiredoxin

      descriptions from strain specific annotations:

    • peroxiredoxin
    • bacterioferritin comigratory protein
    • ahpC/TSA family protein
    • alkyl hydroperoxide reductase
    • Thiol peroxidase, Bcp-type
    • Thioredoxin peroxidase
  • strand?: -
  • coordinates?: 5050605..5051057
  • synteny block?: BlockID0037730
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL1921 (bcp)
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1819
    08BA02176:
    C248_1934
    11819-97:
    MS7_1898
    71193:
    ST398NM01_1956
    ECT-R 2:
    ECTR2_1734
    ED133:
    SAOV_1890
    ED98:
    SAAV_1913 (bcp)
    HO 5096 0412:
    SAEMRSA15_17700
    JH1:
    SaurJH1_1951
    JH9:
    SaurJH9_1917
    JKD6008:
    SAA6008_01820 (bcp)
    JKD6159:
    SAA6159_01794 (bcp)
    LGA251:
    SARLGA251_17450
    M013:
    M013TW_1897
    MRSA252:
    SAR1953
    MSHR1132:
    SAMSHR1132_17080
    MSSA476:
    SAS1785
    Mu3:
    SAHV_1848
    Mu50:
    SAV1863
    MW2:
    MW1803
    RF122:
    SAB1796c
    ST398:
    SAPIG1956
    T0131:
    SAT0131_01985
    TCH60:
    HMPREF0772_11281 (bcp)
    TW20:
    SATW20_18570
    USA300_TCH1516:
    USA300HOU_1858 (bcp)
    VC40:
    SAVC_08570

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MLQKGEQFPIFKLENQDGTVITNDTLKGKKAIIYFYPRDNTPTCTTEACDFRDNLEMFND
    N315            MLQKGEQFPIFKLENQDGTVITNDTLKGKKAIIYFYPRDNTPTCTTEACDFRDNLEMFND
    NCTC8325        MLQKGEQFPIFKLENQDGTVITNDTLKGKKAIIYFYPRDNTPTCTTEACDFRDNLEMFND
    Newman          MLQKGEQFPIFKLENQDGTVITNDILKGKKAIIYFYPRDNTPTCTTEACDFRDNLEMFND
    USA300_FPR3757  MLQKGEQFPIFKLENQDGTVITNDTLKGKKAIIYFYPRDNTPTCTTEACDFRDNLEMFND
                    ************************ ***********************************

    COL             LDVAVYGISGDSKKKHQNFIEKHGLNFDLLVDEDFKLAKETGVYQLKKSFGKESMGIVRT
    N315            LDVAVYGISGDSKKKHQNFIEKHGLNFDLLVDEDFKLAKETGVYQLKKSFGKESMGIVRT
    NCTC8325        LDVAVYGISGDSKKKHQNFIEKHGLNFDLLVDEDFKLAKETGVYQLKKSFGKESMGIVRT
    Newman          LDVAVYGISGDSKKKHQNFIEKHGLNFDLLVDEDFKLAKETGVYQLKKSFGKESMGIVRT
    USA300_FPR3757  LDVAVYGISGDSKKKHQNFIEKHGLNFDLLVDEDFKLAKETGVYQLKKSFGKESMGIVRT
                    ************************************************************

    COL             TFIIDEQGKVLDVIEKVKVKTQIEELKNILG
    N315            TFIIDEQGKVLDVIEKVKVKTQIEELKNILG
    NCTC8325        TFIIDEQGKVLDVIEKVKVKTQIEELKNILG
    Newman          TFIIDEQGKVLDVIEKVKVKTQIEELKNILG
    USA300_FPR3757  TFIIDEQGKVLDVIEKVKVKTQIEELKNILG
                    *******************************