From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1812 [new locus tag: NWMN_RS10410 ]
  • pan locus tag?: SAUPAN001766000
  • symbol: NWMN_1812
  • pan gene symbol?:
  • synonym:
  • product: phage repressor

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1812 [new locus tag: NWMN_RS10410 ]
  • symbol: NWMN_1812
  • product: phage repressor
  • replicon: chromosome
  • strand: +
  • coordinates: 2020253..2020891
  • length: 639
  • essential: unknown

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    ATGGCTTTCAAAAATTCCATAAAAGAAATCAGATTGAACAATAGATTGTCTAAAGTTGAG
    ATGGCTAAAAAATTAGATGTTTCCGAAGGTACTATAAGAATGTGGGAAAGTGGAAGAACT
    GAACCTAGAATGGGTATGGTCGAAAAAATTTCAAGTTTGTTCAATGTTTCTAAAGGTTAT
    CTCTTAGGAGAAATTGAAGAAATTGTTTTACCAGAATTTGATAGCGAAATCGAGGTTCCA
    TATTTCGGTAAAGTTTCTGCTGGAAATTTCGAGGAAGTTGCAATTGATAATGAAAAATTA
    AAAGTTCCACCATTTGCTTTTAACGGTCGTAAACCTAGCGAATGTATAGCACTAAAAATA
    AACGGAGATAGCATGAATAAAATACTCGCTAACGGTTCTTATATAATTGTCCATGATTAT
    AGAAAGTCTTGTGATCATAAACTTAACAGCAATGACATCCTTGTATTACGTCTAGGTGGT
    GAATATACAGTTAAGCGTGTGAGACGTACTGAAACAAAACTACATTTAGACCCAGCAAGC
    TATTCAGATGAATTTAAAACTAATTCTTACGATTTAGATTCTATTGATGAAATCGAAGTG
    ATAGGCAAAGTTATTTATAACTATCGTATTTTTGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    639

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1812 [new locus tag: NWMN_RS10410 ]
  • symbol: NWMN_1812
  • description: phage repressor
  • length: 212
  • theoretical pI: 5.8325
  • theoretical MW: 24241.6
  • GRAVY: -0.39717

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingDNA metabolismDNA replication, recombination, and repairrepressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 40.9)
    Signal transductionRegulatory functionsDNA interactionsrepressor LexA (TIGR00498; EC 3.4.21.88; HMM-score: 40.9)
    Signal transductionRegulatory functionsDNA interactionstranscriptional regulator, y4mF family (TIGR03070; HMM-score: 22.8)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingsignal peptidase I (TIGR02227; EC 3.4.21.89; HMM-score: 20.4)
    Hypothetical proteinsConservedTIGR00270 family protein (TIGR00270; HMM-score: 19.7)
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 18.9)
    Cellular processesCellular processesDetoxificationnickel-type superoxide dismutase maturation protease (TIGR02754; EC 3.4.21.-; HMM-score: 13.1)
    Genetic information processingProtein fateProtein modification and repairnickel-type superoxide dismutase maturation protease (TIGR02754; EC 3.4.21.-; HMM-score: 13.1)
  • TheSEED:  
    LexA repressor (EC 3.4.21.88) 
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 49.2)
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 35.9)
    Peptidase_SF (CL0299) Peptidase_S24; Peptidase S24-like (PF00717; HMM-score: 34.9)
    HTH (CL0123) HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 26.4)
    YdaS_antitoxin; Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT (PF15943; HMM-score: 15)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 14.2)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 12.8)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 12.5)
    MerR; MerR family regulatory protein (PF00376; HMM-score: 12.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.14
    • Ymax_pos: 14
    • Cmax: 0.11
    • Cmax_pos: 46
    • Smax: 0.235
    • Smax_pos: 13
    • Smean: 0.197
    • D: 0.162
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MAFKNSIKEIRLNNRLSKVEMAKKLDVSEGTIRMWESGRTEPRMGMVEKISSLFNVSKGYLLGEIEEIVLPEFDSEIEVPYFGKVSAGNFEEVAIDNEKLKVPPFAFNGRKPSECIALKINGDSMNKILANGSYIIVHDYRKSCDHKLNSNDILVLRLGGEYTVKRVRRTETKLHLDPASYSDEFKTNSYDLDSIDEIEVIGKVIYNYRIFD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]