From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1816 [new locus tag: NWMN_RS10435 ]
  • pan locus tag?: SAUPAN004892000
  • symbol: NWMN_1816
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1816 [new locus tag: NWMN_RS10435 ]
  • symbol: NWMN_1816
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2024623..2025153
  • length: 531
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGACAAATCAGGACAGACCAATGAAATCTATGTCAGAATCAAAATGTTATAAAAATAGA
    CAAGTTTTCCCTCAAGATACGAATCACCATCATACAATGTTTGGTGGTACATTGATGGCT
    AATATTGATGAAATTGCAGCAATCACAGCTATGAAACATGCTGGTGCGCAAGTAGTTACC
    GCATCTACAGACTCAGTAGATTTCTTAAAGCCGATTAAAACAGGGGACATATTACAATAC
    GTAGCGATGGTTTCATACGCTGGGACTAGTTCAATGGAAGTGGTCGTTCAAATTAGAATT
    GACGATGTATTTAATAACAAGCATGATTTAGCTGCATTAAGTTACTTAACATTTGTTGCG
    TTAGATGATGAAGGCAAACCTAAACATGTACCTGGTGTATATCCAGAAGATGATGTTGAA
    AAATGGTTTTATGATACAGCACCACAACGTGTTGAACGAAGAAAAGCACGTCGCATTGAA
    AGTAAACAAACAATTGAATATTTAGCTCAAGTGCAACATATTAGAGACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    531

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1816 [new locus tag: NWMN_RS10435 ]
  • symbol: NWMN_1816
  • description: hypothetical protein
  • length: 176
  • theoretical pI: 6.63196
  • theoretical MW: 19992.5
  • GRAVY: -0.488636

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    uncharacterized domain 1 (TIGR00369; HMM-score: 27.8)
    phenylacetic acid degradation protein PaaD (TIGR02286; HMM-score: 24.2)
  • TheSEED:  
    CBSS-176280.1.peg.1561 Acyl-CoA hydrolase (EC 3.1.2.20) 
  • PFAM:
    HotDog (CL0050) 4HBT; Thioesterase superfamily (PF03061; HMM-score: 62.3)
    YiiD_C; Putative thioesterase (yiiD_Cterm) (PF09500; HMM-score: 13.4)
    no clan definedDUF4426; Domain of unknown function (DUF4426) (PF14467; HMM-score: 13.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.209
    • Ymax_pos: 13
    • Cmax: 0.219
    • Cmax_pos: 62
    • Smax: 0.537
    • Smax_pos: 8
    • Smean: 0.42
    • D: 0.291
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MTNQDRPMKSMSESKCYKNRQVFPQDTNHHHTMFGGTLMANIDEIAAITAMKHAGAQVVTASTDSVDFLKPIKTGDILQYVAMVSYAGTSSMEVVVQIRIDDVFNNKHDLAALSYLTFVALDDEGKPKHVPGVYPEDDVEKWFYDTAPQRVERRKARRIESKQTIEYLAQVQHIRD

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]