From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004892000
  • symbol?:
  • description?: acyl-CoA thioesterase

      descriptions from strain specific annotations:

    • acyl-CoA thioesterase
    • Acyl-CoA hydrolase
    • thioesterase superfamily protein
    • acyl-CoA thioester hydrolase
    • cytosolic long-chain acyl-CoA thioester hydrolase
  • strand?: -
  • coordinates?: 5090639..5091169
  • synteny block?: BlockID0037980
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1834
    08BA02176:
    C248_1950
    11819-97:
    MS7_1913
    71193:
    ST398NM01_1971
    ECT-R 2:
    ECTR2_1749
    ED133:
    SAOV_1976
    ED98:
    SAAV_1943
    HO 5096 0412:
    SAEMRSA15_17850
    JH1:
    SaurJH1_1966
    JH9:
    SaurJH9_1932
    JKD6008:
    SAA6008_01898
    JKD6159:
    SAA6159_01809
    LGA251:
    SARLGA251_17600
    M013:
    M013TW_1914
    MRSA252:
    SAR1968
    MSHR1132:
    SAMSHR1132_17230
    MSSA476:
    SAS1800
    Mu3:
    SAHV_1863
    Mu50:
    SAV1878
    MW2:
    MW1818
    RF122:
    SAB1810c
    ST398:
    SAPIG1971
    T0131:
    SAT0131_02001 (uvrA)
    TCH60:
    HMPREF0772_11266
    TW20:
    SATW20_18720
    USA300_TCH1516:
    USA300HOU_1873
    VC40:
    SAVC_08645

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTNQDRPMKSMSESKCYKNRQVFPQDTNHHHTMFGGTLMANIDEIAAITAMKHAGAQVVT
    N315            MTNQDRPMKSMSESKCYKNRQVFPQDTNHHHTMFGGTLMANIDEIAAITAMKHAGAQVVT
    NCTC8325        MTNQDRPMKSMSESKCYKNRQVFPQDTNHHHTMFGGTLMANIDEIAAITAMKHAGAQVVT
    Newman          MTNQDRPMKSMSESKCYKNRQVFPQDTNHHHTMFGGTLMANIDEIAAITAMKHAGAQVVT
    USA300_FPR3757  MTNQDRPMKSMSESKCYKNRQVFPQDTNHHHTMFGGTLMANIDEIAAITAMKHAGAQVVT
                    ************************************************************

    COL             ASTDSVDFLKPIKTGDILQYVAMVSYAGTSSMEVVVQIRIDDVFNNKHDLAALSYLTFVA
    N315            ASTDSVDFLKPIKTGDILQYVAMVSYAGTSSMEVVVQIRIDDVFNNKHDLAALSYLTFVA
    NCTC8325        ASTDSVDFLKPIKTGDILQYVAMVSYAGTSSMEVVVQIRIDDVFNNKHDLAALSYLTFVA
    Newman          ASTDSVDFLKPIKTGDILQYVAMVSYAGTSSMEVVVQIRIDDVFNNKHDLAALSYLTFVA
    USA300_FPR3757  ASTDSVDFLKPIKTGDILQYVAMVSYAGTSSMEVVVQIRIDDVFNNKHDLAALSYLTFVA
                    ************************************************************

    COL             LDDEGKPKHVPGVYPEDDVEKWFYDTAPQRVERRKARRIESKQTIEYLAQVQHIRD
    N315            LDDEGKPKHVPGVYPEDDVEKWFYDTAPQRVERRKARRIESKQTIEYLAQVQHIRD
    NCTC8325        LDDEGKPKHVPGVYPEDDVEKWFYDTAPQRVERRKARRIESKQTIEYLAQVQHIRD
    Newman          LDDEGKPKHVPGVYPEDDVEKWFYDTAPQRVERRKARRIESKQTIEYLAQVQHIRD
    USA300_FPR3757  LDDEGKPKHVPGVYPEDDVEKWFYDTAPQRVERRKARRIESKQTIEYLAQVQHIRD
                    ********************************************************