From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1829 [new locus tag: NWMN_RS10510 ]
  • pan locus tag?: SAUPAN004913000
  • symbol: NWMN_1829
  • pan gene symbol?: gatD
  • synonym:
  • product: CobB/CobQ-like glutamine amidotransferase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1829 [new locus tag: NWMN_RS10510 ]
  • symbol: NWMN_1829
  • product: CobB/CobQ-like glutamine amidotransferase
  • replicon: chromosome
  • strand: -
  • coordinates: 2035585..2036316
  • length: 732
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGCATGAATTGACTATTTATCATTTTATGTCAGATAAATTGAATTTATACAGTGATATA
    GGAAATATTATTGCTTTAAGACAACGTGCTAAAAAACGAAATATTAAAGTTAATGTCGTA
    GAAATCAATGAAACAGAAGGTATTACCTTTGATGAATGTGATATTTTCTTTATCGGTGGT
    GGAAGTGATAGAGAACAAGCATTAGCAACAAAAGAATTAAGTAAAATTAAGACACCACTT
    AAAGAAGCGATTGAAGATGGTATGCCGGGATTAACGATTTGTGGAGGCTATCAATTTTTA
    GGGAAAAAATATATCACGCCTGATGGTACAGAATTAGAAGGGTTAGGTATTTTAGATTTT
    TATACTGAATCAAAGACAAACCGATTAACAGGAGATATTGTTATCGAAAGTGATACTTTT
    GGAACTATTGTAGGTTTTGAAAATCACGGTGGTAGAACATATCATGATTTCGGTACACTT
    GGTCATGTTACTTTTGGTTATGGTAATAATGATGAAGATAAAAAAGAAGGCATTCATTAT
    AAAAATTTATTAGGTACTTATTTACATGGACCAATTTTACCTAAAAATTACGAAATCACT
    GATTATCTGTTAGAAAAAGCTTGTGAACGTAAGGGTATTCCGTTTGAGCCTAAAGAAATA
    GATAATGAAGCGGAAATACAAGCGAAACAAGTATTAATAGACAGAGCAAATAGACAGAAG
    AAATCTCGTTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    732

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1829 [new locus tag: NWMN_RS10510 ]
  • symbol: NWMN_1829
  • description: CobB/CobQ-like glutamine amidotransferase
  • length: 243
  • theoretical pI: 5.41856
  • theoretical MW: 27429.8
  • GRAVY: -0.530864

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalamincobyric acid synthase CobQ (TIGR00313; EC 6.3.5.10; HMM-score: 55)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersPyridoxinepyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 (TIGR03800; EC 2.6.-.-; HMM-score: 19.8)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalamincobyrinic acid a,c-diamide synthase (TIGR00379; EC 6.3.1.-; HMM-score: 19)
    MetabolismAmino acid biosynthesisHistidine familyimidazole glycerol phosphate synthase, glutamine amidotransferase subunit (TIGR01855; EC 2.4.2.-; HMM-score: 16.9)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotidesPurine ribonucleotide biosynthesisphosphoribosylformylglycinamidine synthase I (TIGR01737; EC 6.3.5.3; HMM-score: 14.4)
  • TheSEED:  
    Putative amidotransferase similar to cobyric acid synthase 
  • PFAM:
    Glutaminase_I (CL0014) GATase_3; CobB/CobQ-like glutamine amidotransferase domain (PF07685; HMM-score: 148.6)
    GATase; Glutamine amidotransferase class-I (PF00117; HMM-score: 23.4)
    DJ-1_PfpI; DJ-1/PfpI family (PF01965; HMM-score: 14.3)
    no clan definedDUF4154; Domain of unknown function (DUF4154) (PF13689; HMM-score: 12.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.112
    • Ymax_pos: 36
    • Cmax: 0.108
    • Cmax_pos: 26
    • Smax: 0.165
    • Smax_pos: 29
    • Smean: 0.087
    • D: 0.102
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MHELTIYHFMSDKLNLYSDIGNIIALRQRAKKRNIKVNVVEINETEGITFDECDIFFIGGGSDREQALATKELSKIKTPLKEAIEDGMPGLTICGGYQFLGKKYITPDGTELEGLGILDFYTESKTNRLTGDIVIESDTFGTIVGFENHGGRTYHDFGTLGHVTFGYGNNDEDKKEGIHYKNLLGTYLHGPILPKNYEITDYLLEKACERKGIPFEPKEIDNEAEIQAKQVLIDRANRQKKSR

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]

Daniela Münch, Terry Roemer, Sang Ho Lee, Marianne Engeser, Hans Georg Sahl, Tanja Schneider
Identification and in vitro analysis of the GatD/MurT enzyme-complex catalyzing lipid II amidation in Staphylococcus aureus.
PLoS Pathog.: 2012, 8(1);e1002509
[PubMed:22291598] [WorldCat.org] [DOI] (I p)