From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004913000
  • symbol?: gatD
  • description?: cobyric acid synthase CobQ

      descriptions from strain specific annotations:

    • cobyric acid synthase CobQ
    • glutamine amidotransferase
    • cobyric acid synthase, putative
    • Cobyric acid synthase
    • cobB/CobQ-like glutamine amidotransferase domain protein
    • CobB/CobQ-like glutamine amidotransferase
    • adenosylcobyric acid synthase (glutamine-hydrolyzing)
    • CobB/CobQ domain-containing protein glutamine amidotransferase
    • putative amidotransferase, putative cobyricacid synthase
    • CobB/CobQ-like glutamine amidotransferase domain-containing protein
  • strand?: -
  • coordinates?: 5102349..5103080
  • synteny block?: BlockID0038190
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1847 (cobQ)
    08BA02176:
    C248_1964
    11819-97:
    MS7_1926
    71193:
    ST398NM01_1984
    ECT-R 2:
    ECTR2_1762
    ED133:
    SAOV_1990
    ED98:
    SAAV_1956
    HO 5096 0412:
    SAEMRSA15_17980
    JH1:
    SaurJH1_1979
    JH9:
    SaurJH9_1945
    JKD6008:
    SAA6008_01911
    JKD6159:
    SAA6159_01822
    LGA251:
    SARLGA251_17730
    M013:
    M013TW_1927
    MRSA252:
    SAR1982
    MSHR1132:
    SAMSHR1132_17350
    MSSA476:
    SAS1813
    Mu3:
    SAHV_1876
    Mu50:
    SAV1891
    MW2:
    MW1832
    RF122:
    SAB1823c
    ST398:
    SAPIG1984
    T0131:
    SAT0131_02016 (clpP)
    TCH60:
    HMPREF0772_11252
    TW20:
    SATW20_18850
    USA300_TCH1516:
    USA300HOU_1889
    VC40:
    SAVC_08715

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MHELTIYHFMSDKLNLYSDIGNIIALRQRAKKRNIKVNVVEINETEGITFDECDIFFIGG
    N315            MHELTIYHFMSDKLNLYSDIGNIIALRQRAKKRNIKVNVVEINETEGITFDECDIFFIGG
    NCTC8325        MHELTIYHFMSDKLNLYSDIGNIIALRQRAKKRNIKVNVVEINETEGITFDECDIFFIGG
    Newman          MHELTIYHFMSDKLNLYSDIGNIIALRQRAKKRNIKVNVVEINETEGITFDECDIFFIGG
    USA300_FPR3757  MHELTIYHFMSDKLNLYSDIGNIIALRQRAKKRNIKVNVVEINETEGITFDECDIFFIGG
                    ************************************************************

    COL             GSDREQALATKELSKIKTPLKEAIEDGMPGLTICGGYQFLGKKYITPDGTELEGLGILDF
    N315            GSDREQALATKELSKIKTPLKEAIEDGMPGLTICGGYQFLGKKYITPDGTELEGLGILDF
    NCTC8325        GSDREQALATKELSKIKTPLKEAIEDGMPGLTICGGYQFLGKKYITPDGTELEGLGILDF
    Newman          GSDREQALATKELSKIKTPLKEAIEDGMPGLTICGGYQFLGKKYITPDGTELEGLGILDF
    USA300_FPR3757  GSDREQALATKELSKIKTPLKEAIEDGMPGLTICGGYQFLGKKYITPDGTELEGLGILDF
                    ************************************************************

    COL             YTESKTNRLTGDIVIESDTFGTIVGFENHGGRTYHDFGTLGHVTFGYGNNDEDKKEGIHY
    N315            YTESKTNRLTGDIVIESDTFGTIVGFENHGGRTYHDFGTLGHVTFGYGNNDEDKKEGIHY
    NCTC8325        YTESKTNRLTGDIVIESDTFGTIVGFENHGGRTYHDFGTLGHVTFGYGNNDEDKKEGIHY
    Newman          YTESKTNRLTGDIVIESDTFGTIVGFENHGGRTYHDFGTLGHVTFGYGNNDEDKKEGIHY
    USA300_FPR3757  YTESKTNRLTGDIVIESDTFGTIVGFENHGGRTYHDFGTLGHVTFGYGNNDEDKKEGIHY
                    ************************************************************

    COL             KNLLGTYLHGPILPKNYEITDYLLEKACERKGIPFEPKEIDNEAEIQAKQVLIDRANRQK
    N315            KNLLGTYLHGPILPKNYEITDYLLEKACERKGIPFEPKEIDNEAEIQAKQVLIDRANRQK
    NCTC8325        KNLLGTYLHGPILPKNYEITDYLLEKACERKGIPFEPKEIDNEAEIQAKQVLIDRANRQK
    Newman          KNLLGTYLHGPILPKNYEITDYLLEKACERKGIPFEPKEIDNEAEIQAKQVLIDRANRQK
    USA300_FPR3757  KNLLGTYLHGPILPKNYEITDYLLEKACERKGIPFEPKEIDNEAEIQAKQVLIDRANRQK
                    ************************************************************

    COL             KSR
    N315            KSR
    NCTC8325        KSR
    Newman          KSR
    USA300_FPR3757  KSR
                    ***