From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1920 [new locus tag: NWMN_RS11075 ]
  • pan locus tag?: SAUPAN005131000
  • symbol: NWMN_1920
  • pan gene symbol?:
  • synonym:
  • product: phage transcriptional regulator

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1920 [new locus tag: NWMN_RS11075 ]
  • symbol: NWMN_1920
  • product: phage transcriptional regulator
  • replicon: chromosome
  • strand: -
  • coordinates: 2127771..2128034
  • length: 264
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    ATGAAAACATTAAAAGAGTTGAGGACTGATTACGGATTGACTCAAAAAGAGTTAGGAGAT
    TTATTTAAGGTCTCATCACGTACAATTCAAAATATGGAAAAAGACTCTACAAACATTAAA
    GATAGTTTACTTTCTAAGTATATGAGTGCTTTTAATGTTAAATATGATGATATTTTTTTA
    GGTAATGAATACGAAAATTTCGTATTTACGAATGATAAAAAGAAATCAATTATTTTAGCA
    TTTAAAGAAAAACAAACATCTTAA
    60
    120
    180
    240
    264

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1920 [new locus tag: NWMN_RS11075 ]
  • symbol: NWMN_1920
  • description: phage transcriptional regulator
  • length: 87
  • theoretical pI: 9.38942
  • theoretical MW: 10174.6
  • GRAVY: -0.678161

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Signal transductionRegulatory functionsDNA interactionstranscriptional regulator, y4mF family (TIGR03070; HMM-score: 33.5)
    putative zinc finger/helix-turn-helix protein, YgiT family (TIGR03830; HMM-score: 21.7)
  • TheSEED:  
    DNA-binding protein, phage associated 
  • PFAM:
    HTH (CL0123) HTH_3; Helix-turn-helix (PF01381; HMM-score: 39.1)
    HTH_19; Helix-turn-helix domain (PF12844; HMM-score: 28.3)
    HTH_31; Helix-turn-helix domain (PF13560; HMM-score: 22.9)
    HTH_26; Cro/C1-type HTH DNA-binding domain (PF13443; HMM-score: 17.2)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 16.8)
    HTH_11; HTH domain (PF08279; HMM-score: 16.6)
    HTH_25; Helix-turn-helix domain (PF13413; HMM-score: 15.3)
    HTH_23; Homeodomain-like domain (PF13384; HMM-score: 14.6)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 12.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: unknown (no significant prediction)
    • Cytoplasmic Score: 2.5
    • Cytoplasmic Membrane Score: 2.5
    • Cellwall Score: 2.5
    • Extracellular Score: 2.5
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.117
    • Ymax_pos: 13
    • Cmax: 0.108
    • Cmax_pos: 36
    • Smax: 0.164
    • Smax_pos: 12
    • Smean: 0.133
    • D: 0.123
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKTLKELRTDYGLTQKELGDLFKVSSRTIQNMEKDSTNIKDSLLSKYMSAFNVKYDDIFLGNEYENFVFTNDKKKSIILAFKEKQTS

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • NWMN_1920 no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]