From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40

Summary[edit source | edit]

  • pan ID?: SAUPAN005131000
  • symbol?:
  • description?: transcriptional regulator

      descriptions from strain specific annotations:

    • transcriptional regulator
    • helix-turn-helix domain-containing protein
    • phage transcriptional regulator
    • putative phage transcriptional regulator
    • DNA-binding protein, phage associated
    • helix-turn-helix family protein
    • phage DNA-binding protein
    • Phage transcriptional regulator, Cro/CI family
  • strand?: -
  • coordinates?: 5266538..5266801
  • synteny block?: BlockID0039830
  • occurrence?: in 31% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1958
    08BA02176:
    11819-97:
    71193:
    ST398NM01_2957
    ECT-R 2:
    ECTR2_1867
    ED133:
    ED98:
    HO 5096 0412:
    JH1:
    JH9:
    JKD6008:
    JKD6159:
    LGA251:
    M013:
    MRSA252:
    SAR2099
    MSHR1132:
    MSSA476:
    Mu3:
    Mu50:
    MW2:
    RF122:
    ST398:
    T0131:
    TCH60:
    TW20:
    SATW20_19940
    USA300_TCH1516:
    USA300HOU_2003
    VC40:

Genome Viewer[edit source | edit]

N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    N315            ------------------------------------------------------------
    NCTC8325        ------------------------------------------------------------
    Newman          ------------------------------------------------------------
    USA300_FPR3757  MRNFLMFLAIIIFLSLFILLTSFFLIIRNFHIIVKFFYEKNVFNVDNTKISYYIRFTKGG
                                                                                

    N315            --MKTLKELRTDYGLTQKELGDLFKVSSRTIQNMEKDSTNIKDSLLSKYMSAFNVKYDDI
    NCTC8325        --MKTLKELRTDYGLTQKELGDLFKVSSRTIQNMEKDSTNIKDSLLSKYMSAFNVKYDDI
    Newman          --MKTLKELRTDYGLTQKELGDLFKVSSRTIQNMEKDSTNIKDSLLSKYMSAFNVKYDDI
    USA300_FPR3757  DNMKTLKELRTDYGLTQKELGDLFKVSSRTIQNMEKDSTNIKDSLLSKYMSAFNVKYDDI
                      **********************************************************

    N315            FLGNEYENFVFTNDKKKSIILAFKEKQTS
    NCTC8325        FLGNEYENFVFTNDKKKSIILAFKEKQTS
    Newman          FLGNEYENFVFTNDKKKSIILAFKEKQTS
    USA300_FPR3757  FLGNEYENFVFTNDKKKSIILAFKEKQTS
                    *****************************