From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_1977 [new locus tag: NWMN_RS11440 ]
  • pan locus tag?: SAUPAN005343000
  • symbol: NWMN_1977
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_1977 [new locus tag: NWMN_RS11440 ]
  • symbol: NWMN_1977
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2194789..2195280
  • length: 492
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    ATGAGGGATTATAATTTTATGTCACCACACGCTAAAAAAGTGATGAGGTTAAGTGCTGTG
    CTGTTTTGGATACCCATAGCGCTTGTACTTTTAATCGCATTTAATATTTTGAACTGGCTA
    TTTTGGGAGATTTTAGATAACCATTTATCCATTGTTAGTAGTGTGATTATAATATTACTT
    GTTGCTGTTTTCACGCTTGTTATAGCGCCAGTCTATCGATATAAGCACTGCAGATATGCA
    TTTGAAAAACACCATTTGCGTGTACGAAACGGCATTTTATTTTTGGATGAAAAGGTAATA
    CCATATTTTCGTATTCAAAATATTGATATCGATGTTGGTCCTATAATGAGACGCTATCGA
    TTAGCAACTTTGACCCTTTATACAGCGGGTGGTCAAGCTGAAATTGAATTAATAGATAGA
    AGTGAAGCACGTAGATTGAAACGATGGTTAAATAACGAGAGACATTTAGAAAACAATAAA
    AATGAGGAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    492

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_1977 [new locus tag: NWMN_RS11440 ]
  • symbol: NWMN_1977
  • description: hypothetical protein
  • length: 163
  • theoretical pI: 9.99463
  • theoretical MW: 19404.8
  • GRAVY: 0.134356

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Cofactors, Vitamins, Prosthetic Groups, PigmentsTetrapyrrolesCPO analysis Hypothetical protein, ydbS homolog 
  • PFAM:
    PH (CL0266) bPH_2; Bacterial PH domain (PF03703; HMM-score: 69.8)
    no clan definedDUF2207; Predicted membrane protein (DUF2207) (PF09972; HMM-score: 16.3)
    PH (CL0266) Rtt106; Histone chaperone Rttp106-like (PF08512; HMM-score: 15.4)
    no clan definedRseC_MucC; Positive regulator of sigma(E), RseC/MucC (PF04246; HMM-score: 12.7)
    PH (CL0266) bPH_3; Bacterial PH domain (PF14470; HMM-score: 12.7)
    no clan definedDUF3974; Domain of unknown function (DUF3974) (PF13120; HMM-score: 12.1)
    YlaC; Inner membrane protein YlaC (PF10777; HMM-score: 10)
    DUF4191; Domain of unknown function (DUF4191) (PF13829; HMM-score: 6.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 1.78
    • Cytoplasmic Membrane Score: 8.16
    • Cellwall Score: 0.06
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.21
    • Ymax_pos: 15
    • Cmax: 0.12
    • Cmax_pos: 46
    • Smax: 0.527
    • Smax_pos: 6
    • Smean: 0.435
    • D: 0.298
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MRDYNFMSPHAKKVMRLSAVLFWIPIALVLLIAFNILNWLFWEILDNHLSIVSSVIIILLVAVFTLVIAPVYRYKHCRYAFEKHHLRVRNGILFLDEKVIPYFRIQNIDIDVGPIMRRYRLATLTLYTAGGQAEIELIDRSEARRLKRWLNNERHLENNKNEE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]