From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2012 [new locus tag: NWMN_RS11635 ]
  • pan locus tag?: SAUPAN005399000
  • symbol: atpE
  • pan gene symbol?: atpE
  • synonym:
  • product: F0F1 ATP synthase subunit C

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2012 [new locus tag: NWMN_RS11635 ]
  • symbol: atpE
  • product: F0F1 ATP synthase subunit C
  • replicon: chromosome
  • strand: -
  • coordinates: 2230641..2230853
  • length: 213
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    ATGAATTTAATCGCAGCAGCAATCGCAATTGGTTTATCAGCATTAGGAGCAGGTATCGGT
    AACGGTTTAATCGTTTCAAGAACAGTTGAAGGTGTAGCACGTCAACCAGAAGCACGTGGT
    CAATTAATGGGTATCATGTTCATTGGTGTAGGTTTAGTTGAGGCATTACCTATCATCGGT
    GTAGTAATTGCATTCATGACATTTGCTGGATAA
    60
    120
    180
    213

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2012 [new locus tag: NWMN_RS11635 ]
  • symbol: AtpE
  • description: F0F1 ATP synthase subunit C
  • length: 70
  • theoretical pI: 6.61182
  • theoretical MW: 6979.38
  • GRAVY: 1.25429

Function[edit source | edit]

  • reaction:
    EC 3.6.3.14?  ExPASy
    H+-transporting two-sector ATPaseATP + H2O + H+(In) = ADP + phosphate + H+(Out)
  • TIGRFAM:
    MetabolismEnergy metabolismATP-proton motive force interconversionATP synthase F0, C subunit (TIGR01260; EC 3.6.3.14; HMM-score: 73.7)
    alternate F1F0 ATPase, F0 subunit C (TIGR03322; EC 3.6.3.-; HMM-score: 31.8)
  • TheSEED:  
    F0F1-type ATP synthase ATP synthase F0 sector subunit c (EC 3.6.3.14) 
  • PFAM:
    no clan definedATP-synt_C; ATP synthase subunit C (PF00137; HMM-score: 55.1)
    DUF5362; Family of unknown function (DUF5362) (PF17319; HMM-score: 16.6)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic Membrane
    • Cytoplasmic Score: 0.32
    • Cytoplasmic Membrane Score: 9.55
    • Cellwall Score: 0.12
    • Extracellular Score: 0.01
    • Internal Helices: 2
  • LocateP: Multi-transmembrane
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0
    • Signal Peptide Possibility: -0.5
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.16
    • Ymax_pos: 23
    • Cmax: 0.121
    • Cmax_pos: 56
    • Smax: 0.305
    • Smax_pos: 1
    • Smean: 0.226
    • D: 0.186
  • predicted transmembrane helices (TMHMM): 2

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIGVVIAFMTFAG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]