From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005399000
  • symbol?: atpE
  • description?: F0F1 ATP synthase subunit C

      descriptions from strain specific annotations:

    • F0F1 ATP synthase subunit C
    • ATP synthase subunit C
    • ATP synthase F0F1 subunit C
    • ATP synthase C chain
    • ATP synthase F0, C subunit
    • ATP synthase F0 subunit C
    • ATP synthase subunit C, AtpC
  • strand?: -
  • coordinates?: 5561166..5561378
  • synteny block?: BlockID0041950
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2100 (atpE)
    N315:
    SA1910 (atpE)
    NCTC8325:
    Newman:
    NWMN_2012 (atpE)
    USA300_FPR3757:
    04-02981:
    SA2981_2048 (atpE)
    08BA02176:
    C248_2122 (atpE)
    11819-97:
    MS7_2124 (atpE)
    71193:
    ST398NM01_2150
    ECT-R 2:
    ECTR2_1964 (atpE)
    ED133:
    SAOV_2149c
    ED98:
    SAAV_2163 (atpE)
    HO 5096 0412:
    SAEMRSA15_20160 (atpE)
    JH1:
    SaurJH1_2182
    JH9:
    SaurJH9_2144
    JKD6008:
    SAA6008_02146 (atpC)
    JKD6159:
    SAA6159_02022 (atpC)
    LGA251:
    SARLGA251_19090 (atpE)
    M013:
    M013TW_2067
    MRSA252:
    SAR2196 (atpE)
    MSHR1132:
    SAMSHR1132_19310
    MSSA476:
    SAS2011
    Mu3:
    SAHV_2092 (atpE)
    Mu50:
    SAV2108 (atpE)
    MW2:
    MW2032 (atpE)
    RF122:
    SAB1992c (atpE)
    ST398:
    SAPIG2150 (atpE)
    T0131:
    SAT0131_02270 (oppD)
    TCH60:
    HMPREF0772_11083 (atpE)
    TW20:
    SATW20_22460 (atpE)
    USA300_TCH1516:
    USA300HOU_2098 (atpE)
    VC40:
    SAVC_09415

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG
    N315            MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG
    NCTC8325        MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG
    Newman          MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG
    USA300_FPR3757  MNLIAAAIAIGLSALGAGIGNGLIVSRTVEGVARQPEARGQLMGIMFIGVGLVEALPIIG
                    ************************************************************

    COL             VVIAFMTFAG
    N315            VVIAFMTFAG
    NCTC8325        VVIAFMTFAG
    Newman          VVIAFMTFAG
    USA300_FPR3757  VVIAFMTFAG
                    **********