From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2097 [new locus tag: NWMN_RS12135 ]
  • pan locus tag?: SAUPAN005589000
  • symbol: lacC
  • pan gene symbol?: lacC
  • synonym:
  • product: tagatose-6-phosphate kinase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2097 [new locus tag: NWMN_RS12135 ]
  • symbol: lacC
  • product: tagatose-6-phosphate kinase
  • replicon: chromosome
  • strand: -
  • coordinates: 2335351..2336283
  • length: 933
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    ATGATTTTAACTTTAACATTAAATCCATCCGTTGATATTTCATACCCATTAACAGCATTG
    AAATTAGATGATGTTAATCGTGTTCAAGAAGTAAGTAAAACAGCTGGTGGTAAAGGTTTA
    AATGTAACAAGAGTACTTGCGCAAGTAGGTGAGCCAGTCCTTGCGAGTGGTTTTATTGGC
    GGTGAATTAGGTCAATTTATTGCTAAAAAATTAGATCATGCCGACATCAAGCATGCATTT
    TATAACATTAAGGGTGAAACACGAAACTGCATTGCAATTTTACATGAAGGGCAACAAACA
    GAAATTTTAGAGCAGGGACCGGAGATTGATAATCAAGAGGCTGCAGGATTTATTAAACAT
    TTTGAACAATTATTAGAAAAAGTTGAAGCAGTTGCTATTTCAGGTAGCTTACCTAAAGGA
    TTAAATCAAGATTATTATGCACAAATCATTGAACGATGCCAAAACAAAGGTGTGCCTGTG
    ATATTAGATTGCTCGGGTGCAACTTTGCAAACAGTTTTGGAAAATCCATACAAACCTACA
    GTCATTAAACCAAACATTTCTGAACTATATCAATTGCTTAACCAGCCACTTGATGAAAGT
    TTAGAAAGTTTGAAACAGGCAGTGTCACAACCCTTATTCGAAGGGATTGAGTGGATTATT
    GTGTCTTTAGGTGCACAAGGTGCATTCGCTAAGCACAATCATACATTCTATAGAGTGAAT
    ATTCCGACAATAAGTGTATTAAATCCGGTTGGTTCAGGTGATTCTACAGTTGCTGGAATT
    ACTTCAGCAATTCTTAATCATGAAAACGACCACGATTTACTAAAAAAAGCCAATACTTTA
    GGCATGCTGAATGCACAAGAAGCACAAACAGGTTATGTCAATTTAAATAATTATGATGAT
    TTATTCAATCAAATTGAAGTTTTAGAGGTGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    933

Protein[edit source | edit]

Protein Data Bank: 2Q5R
Protein Data Bank: 2JG1
Protein Data Bank: 2JGV

General[edit source | edit]

  • locus tag: NWMN_2097 [new locus tag: NWMN_RS12135 ]
  • symbol: LacC
  • description: tagatose-6-phosphate kinase
  • length: 310
  • theoretical pI: 4.66037
  • theoretical MW: 33853.2
  • GRAVY: -0.0977419

Function[edit source | edit]

  • reaction:
    EC 2.7.1.144?  ExPASy
    Tagatose-6-phosphate kinaseATP + D-tagatose 6-phosphate = ADP + D-tagatose 1,6-bisphosphate
  • TIGRFAM:
    MetabolismEnergy metabolismBiosynthesis and degradation of polysaccharidestagatose-6-phosphate kinase (TIGR01231; EC 2.7.1.144; HMM-score: 620.2)
    hexose kinase, 1-phosphofructokinase family (TIGR03168; EC 2.7.1.-; HMM-score: 323.1)
    1-phosphofructokinase (TIGR03828; EC 2.7.1.56; HMM-score: 278.5)
    MetabolismEnergy metabolismSugarsribokinase (TIGR02152; EC 2.7.1.15; HMM-score: 64.5)
    Cell structureCell envelopeBiosynthesis and degradation of surface polysaccharides and lipopolysaccharidesbifunctional protein RfaE, domain I (TIGR02198; EC 2.7.1.-; HMM-score: 59.3)
    MetabolismEnergy metabolismSugars5-dehydro-2-deoxygluconokinase (TIGR04382; EC 2.7.1.92; HMM-score: 47.7)
    Unknown functionGeneralYjeF family C-terminal domain (TIGR00196; HMM-score: 41.5)
  • TheSEED:  
    CarbohydratesDi- and oligosaccharidesLactose and Galactose Uptake and Utilization Tagatose-6-phosphate kinase (EC 2.7.1.144) 
    MonosaccharidesD-Tagatose and Galactitol Utilization Tagatose-6-phosphate kinase (EC 2.7.1.144) 
  • PFAM:
    Ribokinase (CL0118) PfkB; pfkB family carbohydrate kinase (PF00294; HMM-score: 217.5)
    Carb_kinase; Carbohydrate kinase (PF01256; HMM-score: 40)
    Phos_pyr_kin; Phosphomethylpyrimidine kinase (PF08543; HMM-score: 19.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: -1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.159
    • Ymax_pos: 23
    • Cmax: 0.174
    • Cmax_pos: 56
    • Smax: 0.324
    • Smax_pos: 9
    • Smean: 0.21
    • D: 0.179
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MILTLTLNPSVDISYPLTALKLDDVNRVQEVSKTAGGKGLNVTRVLAQVGEPVLASGFIGGELGQFIAKKLDHADIKHAFYNIKGETRNCIAILHEGQQTEILEQGPEIDNQEAAGFIKHFEQLLEKVEAVAISGSLPKGLNQDYYAQIIERCQNKGVPVILDCSGATLQTVLENPYKPTVIKPNISELYQLLNQPLDESLESLKQAVSQPLFEGIEWIIVSLGAQGAFAKHNHTFYRVNIPTISVLNPVGSGDSTVAGITSAILNHENDHDLLKKANTLGMLNAQEAQTGYVNLNNYDDLFNQIEVLEV

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]