From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2101 [new locus tag: NWMN_RS12155 ]
  • pan locus tag?: SAUPAN005595000
  • symbol: NWMN_2101
  • pan gene symbol?: cobB
  • synonym:
  • product: NAD-dependent deacetylase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2101 [new locus tag: NWMN_RS12155 ]
  • symbol: NWMN_2101
  • product: NAD-dependent deacetylase
  • replicon: chromosome
  • strand: +
  • coordinates: 2338629..2339360
  • length: 732
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    TTGAAACATGATTTAGAGACACTAAAACATATTATAGATAGTTCGAATCGTATTACATTT
    TTTACAGGTGCTGGTGTATCTGTCGCAAGTGGCGTTCCAGATTTCCGTTCAATGGGTGGC
    TTATTTGATGAAATTTCAAAAGATGGGCTTTCGCCAGAATACTTGTTAAGCCGTGATTAT
    TTAGAAGATGATCCTGAAGGTTTTATCAATTTCTGCCATAAGCGCTTACTATTTGTCGAT
    ACGATGCCCAATATCGTTCATGATTGGATTGCAAAATTAGAACGTAATCAACAATCTTTA
    GGTGTCATCACGCAAAATATCGATGGTTTGCACTCAGACGCTGGAAGTCAACATGTTGAT
    GAATTACATGGCACGTTAAATCGTTTTTATTGTAATGTATGTCATAAATCTTATACGAAG
    TCAGATGTTATTGATAGAACTTTGAAACATTGTGATAATTGTGGTGGTGCCATTCGACCG
    GACATCGTATTATACGGTGAAATGTTAGATCAACCTACCATCATAAGGGCATTAAATAAA
    ATTGAACATGCTGACACCCTTGTTGTACTAGGTTCATCACTCGTTGTACAACCTGCCGCA
    GGATTAATATCACATTTTAAAGGCGACAATTTAATTATTATCAATAAAGATCGAACACCT
    TATGATAGCGACGCTACTTTGGTCATACATGACGACATGGTTTCCGTTGTAAAATCATTA
    ATGACAGAGTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    732

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2101 [new locus tag: NWMN_RS12155 ]
  • symbol: NWMN_2101
  • description: NAD-dependent deacetylase
  • length: 243
  • theoretical pI: 5.27118
  • theoretical MW: 27051.5
  • GRAVY: -0.152675

Function[edit source | edit]

  • reaction:
    EC 3.5.1.-?  ExPASy
    NAD+ + an acetylprotein = nicotinamide + O-acetyl-ADP-ribose + a protein?
  • TIGRFAM:
  • TheSEED:  
    CarbohydratesCentral carbohydrate metabolismPyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate NAD-dependent protein deacetylase of SIR2 family 
    Stress ResponseOxidative stressRedox-dependent regulation of nucleus processes NAD-dependent protein deacetylase of SIR2 family 
  • PFAM:
    FAD_DHS (CL0085) SIR2; Sir2 family (PF02146; HMM-score: 184.3)
    C2H2-zf (CL0361) zf-BED; BED zinc finger (PF02892; HMM-score: 12.7)
    Globin (CL0090) Protoglobin; Protoglobin (PF11563; HMM-score: 12)
    Zn_Beta_Ribbon (CL0167) Zn-ribbon_8; Zinc ribbon domain (PF09723; HMM-score: 11.7)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: Zn2+
  • effectors:
  • protein partners:
    NWMN_0500(rplA)50S ribosomal protein L1  [1] (data from MRSA252)
    NWMN_2151(rplD)50S ribosomal protein L4  [1] (data from MRSA252)
    NWMN_0510(tufA)elongation factor Tu  [1] (data from MRSA252)
    NWMN_0811hypothetical protein  [1] (data from MRSA252)

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.165
    • Ymax_pos: 30
    • Cmax: 0.164
    • Cmax_pos: 30
    • Smax: 0.227
    • Smax_pos: 23
    • Smean: 0.147
    • D: 0.158
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKHDLETLKHIIDSSNRITFFTGAGVSVASGVPDFRSMGGLFDEISKDGLSPEYLLSRDYLEDDPEGFINFCHKRLLFVDTMPNIVHDWIAKLERNQQSLGVITQNIDGLHSDAGSQHVDELHGTLNRFYCNVCHKSYTKSDVIDRTLKHCDNCGGAIRPDIVLYGEMLDQPTIIRALNKIEHADTLVVLGSSLVVQPAAGLISHFKGDNLIIINKDRTPYDSDATLVIHDDMVSVVKSLMTE

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. 1.0 1.1 1.2 1.3 Artem Cherkasov, Michael Hsing, Roya Zoraghi, Leonard J Foster, Raymond H See, Nikolay Stoynov, Jihong Jiang, Sukhbir Kaur, Tian Lian, Linda Jackson, Huansheng Gong, Rick Swayze, Emily Amandoron, Farhad Hormozdiari, Phuong Dao, Cenk Sahinalp, Osvaldo Santos-Filho, Peter Axerio-Cilies, Kendall Byler, William R McMaster, Robert C Brunham, B Brett Finlay, Neil E Reiner
    Mapping the protein interaction network in methicillin-resistant Staphylococcus aureus.
    J. Proteome Res.: 2011, 10(3);1139-50
    [PubMed:21166474] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]