From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005595000
  • symbol?: cobB
  • description?: NAD-dependent deacetylase

      descriptions from strain specific annotations:

    • NAD-dependent deacetylase
    • NAD-dependent protein deacetylase of SIR2 family
    • sir2 family protein
    • Sir2 family NAD-dependent deacetylase
    • NAD-dependent deacetylase (Regulatory protein SIR2homolog)
    • Sir2 family transcriptional regulator
  • strand?: +
  • coordinates?: 5733550..5734290
  • synteny block?: BlockID0043550
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2135
    08BA02176:
    C248_2236
    11819-97:
    MS7_2220
    71193:
    ST398NM01_2257
    ECT-R 2:
    ECTR2_2058
    ED133:
    SAOV_2244
    ED98:
    SAAV_2258
    HO 5096 0412:
    SAEMRSA15_21020
    JH1:
    SaurJH1_2267
    JH9:
    SaurJH9_2228
    JKD6008:
    SAA6008_02238
    JKD6159:
    SAA6159_02108
    LGA251:
    SARLGA251_19920
    M013:
    M013TW_2165
    MRSA252:
    SAR2288
    MSHR1132:
    SAMSHR1132_20290
    MSSA476:
    SAS2098
    Mu3:
    SAHV_2181
    Mu50:
    SAV2197
    MW2:
    MW2123
    RF122:
    SAB2078
    ST398:
    SAPIG2257
    T0131:
    SAT0131_02372
    TCH60:
    HMPREF0772_10994
    TW20:
    SATW20_23350
    USA300_TCH1516:
    USA300HOU_2190
    VC40:
    SAVC_09875

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MKHDLETLKHIIDSSNRITFFTGAGVSVASGVPDFRSMGGLFDEISKDGLSPEYLLS
    N315            ---MRNDLETLKHIIDSSNRITFFTGAGVSVASGVPDFRSMGGLFDEISKDGLSPEYLLS
    NCTC8325        MFNLKHDLETLKHIIDSSNRITFFTGAGVSVASGVPDFRSMGGLFDEISKDGLSPEYLLS
    Newman          ---MKHDLETLKHIIDSSNRITFFTGAGVSVASGVPDFRSMGGLFDEISKDGLSPEYLLS
    USA300_FPR3757  ---MKHDLETLKHIIDSSNRITFFTGAGVSVASGVPDFRSMGGLFDEISKDGLSPEYLLS
                       :::******************************************************

    COL             RDYLEDDPEGFINFCHKRLLFVDTMPNIVHDWIAKLERNQQSLGIITQNIDGLHSDAGSQ
    N315            RDYLEDDPEGFINFCHKRLLFVDTKPNIVHDWIAKLERNQQSLGVITQNIDGLHSDAGSQ
    NCTC8325        RDYLEDDPEGFINFCHKRLLFVDTMPNIVHDWIAKLERNQQSLGVITQNIDGLHSDAGSQ
    Newman          RDYLEDDPEGFINFCHKRLLFVDTMPNIVHDWIAKLERNQQSLGVITQNIDGLHSDAGSQ
    USA300_FPR3757  RDYLEDDPEGFINFCHKRLLFVDTMPNIVHDWIAKLERNQQSLGVITQNIDGLHSDAGSQ
                    ************************ *******************:***************

    COL             HVDELHGTLNRFYCNVCHKSYTKSDVIDRTLKHCDNCGGAIRPDIVLYGEMLDQPTIIRA
    N315            HVDELHGTLNRFYCNACHKSYTKSDVIDRTLKHCDNCGGAIRPDIVLYGEMLDQPTIIRA
    NCTC8325        HVDELHGTLNRFYCNVCHKSYTKSDVIDRTLKHCDNCGGAIRPDIVLYGEMLDQPTIIRA
    Newman          HVDELHGTLNRFYCNVCHKSYTKSDVIDRTLKHCDNCGGAIRPDIVLYGEMLDQPTIIRA
    USA300_FPR3757  HVDELHGTLNRFYCNVCHKSYTKSDVIDRTLKHCDNCGGAIRPDIVLYGEMLDQPTIIRA
                    ***************.********************************************

    COL             LNKIEHADTLVVLGSSLVVQPAAGLISHFKGDNLIIINKDRTPYDSDATLVIHDDMVSVV
    N315            LNKIEHADTLVVLGSSLVVQPAAGLISHFKGDNLIIINKDRTPYDSDATLVIHDDMVSVV
    NCTC8325        LNKIEHADTLVVLGSSLVVQPAAGLISHFKGDNLIIINKDRTPYDSDATLVIHDDMVSVV
    Newman          LNKIEHADTLVVLGSSLVVQPAAGLISHFKGDNLIIINKDRTPYDSDATLVIHDDMVSVV
    USA300_FPR3757  LNKIEHADTLVVLGSSLVVQPAAGLISHFKGDNLIIINKDRTPYDSDATLVIHDDMVSVV
                    ************************************************************

    COL             KSLMTE
    N315            KSLMTE
    NCTC8325        KSLMTE
    Newman          KSLMTE
    USA300_FPR3757  KSLMTE
                    ******