From AureoWiki
Jump to: navigation, search
Pangenome04-0298108BA0217611819-9771193COLECT-R 2ED133ED98HO 5096 0412JH1JH9JKD6008JKD6159LGA251M013MRSA252MSHR1132MSSA476MW2Mu3Mu50N315NCTC8325NewmanRF122ST398T0131TCH60TW20USA300_FPR3757USA300_TCH1516VC40
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2115 [new locus tag: NWMN_RS12235 ]
  • pan locus tag?: SAUPAN005646000
  • symbol: NWMN_2115
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2115 [new locus tag: NWMN_RS12235 ]
  • symbol: NWMN_2115
  • product: hypothetical protein
  • replicon: chromosome
  • strand: -
  • coordinates: 2353183..2354319
  • length: 1137
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    1081
    ATGGAAATTCATGTTTATACGGGACCGCTTTGTGGATTTAATGAATATATTAATTCTGAA
    GTTAAAGAATATCACCGCTTCATGGAATTAATCAGAGAATACAATATCATAGTGCGAGCA
    AGTGATACATTTGGAACTCATGATGTTGATGGTATTTTTGATACTGAGATAGAAAATCTT
    GTGATATTTTCAAACGACTTTGCTTCTGTAACAACTCATGTTATTACTAATTTTATAAAT
    ATCGTTACTTTAGGTAGAAATATTAAGAAAATCTATATTCAGAATCCTCCAAAAAGAGTA
    TTTCAATCACTAAATAGTTTTCACGATTCTGAAATAATAGAAATAAACTATGAATATACA
    ACATTAAAAAAAGATGATGTAATAAATTTTTATAAAGAGCAGATGGCTGGTTCTAAAATA
    ATAGGTCAAACAGACGCTAAAAAACAAATGAGCATAGATTTATATAAACATACTTCCTTA
    GAAAATAATAAACCGACCGTAATGCTTTACTATGGTCCATCAGGTGTTGGAAAAACAGAA
    TTAGCCAAAGAAATAGCAAAAAAATATAAAGGTAATATCACTAGAATACAATTTTCTATG
    ATGCAGAATGATGAATCTTTTAATTATATCTTTGGAGATGAACATGCCAAAGTATCATTG
    TCAAAAGATTTAGTAGATCGTGAAACTAATGTTGTTTTAATTGATGAATTTGATAAGGTA
    TTACCAATCTATTACAATGTTTTCTATCAAATGTTTGATGAAGGTATTATTGAAGATGCC
    AATTATAAAGTAGACGTTTCAAATTGTATTTTCATTCTAACATCTAATTTTAATAGTATT
    GAAGAAGCAATAGTTAATATTGGAGAACCGGTATTTTCTAGAATAGATTCCTGTATTAAA
    TTTTTATATTTAACACAGGAAGAAAAGCAGAAAGTAATAGAAAATAAATTAAATGAAATA
    CTATCATCTCTAAATGAAAAAGAAAAAAGAATAGTTACCGCATATAACTTGTTAGAGAAA
    TATAAAGAGACAGAAATAGATATCGATAACATTAGGTATTTAAAGAAAATAATAACAAAT
    GATATTTATACAATAATTTTTGAAGATGAATTATTTAATACGGATATTATAGATTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1080
    1137

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2115 [new locus tag: NWMN_RS12235 ]
  • symbol: NWMN_2115
  • description: hypothetical protein
  • length: 378
  • theoretical pI: 4.58881
  • theoretical MW: 44099.8
  • GRAVY: -0.289947

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidesATP-dependent Clp protease ATP-binding subunit ClpA (TIGR02639; HMM-score: 67.3)
    Cellular processesCellular processesPathogenesistype VI secretion ATPase, ClpV1 family (TIGR03345; HMM-score: 61.1)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype VI secretion ATPase, ClpV1 family (TIGR03345; HMM-score: 61.1)
    Genetic information processingProtein fateProtein folding and stabilizationATP-dependent chaperone protein ClpB (TIGR03346; HMM-score: 57)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairHolliday junction DNA helicase RuvB (TIGR00635; EC 3.6.4.12; HMM-score: 33.1)
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidesendopeptidase La (TIGR00763; EC 3.4.21.53; HMM-score: 24.8)
    Genetic information processingProtein fateProtein folding and stabilizationATP-dependent protease HslVU, ATPase subunit (TIGR00390; HMM-score: 23.6)
    Cellular processesCellular processesOthergas vesicle protein GvpN (TIGR02640; HMM-score: 19.1)
    26S proteasome subunit P45 family (TIGR01242; HMM-score: 18.3)
    AAA family ATPase, CDC48 subfamily (TIGR01243; HMM-score: 17.2)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairorc1/cdc6 family replication initiation protein (TIGR02928; HMM-score: 15.6)
    Genetic information processingProtein fateDegradation of proteins, peptides, and glycopeptidesproteasome ATPase (TIGR03689; EC 3.6.4.8; HMM-score: 15)
    Cellular processesCellular processesChemotaxis and motilityflagellar biosynthesis protein FlhF (TIGR03499; HMM-score: 13.4)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingsignal recognition particle-docking protein FtsY (TIGR00064; HMM-score: 12.8)
    phosphonate C-P lyase system protein PhnL (TIGR02324; HMM-score: 12.5)
    Genetic information processingProtein fateProtein and peptide secretion and traffickingtype VII secretion AAA-ATPase EccA (TIGR03922; HMM-score: 11)
  • TheSEED:  
    Protein MetabolismProtein degradationProteolysis in bacteria, ATP-dependent ClpB protein 
    Protein foldingProtein chaperones ClpB protein 
  • PFAM:
    P-loop_NTPase (CL0023) AAA_2; AAA domain (Cdc48 subfamily) (PF07724; HMM-score: 56.2)
    AAA; ATPase family associated with various cellular activities (AAA) (PF00004; HMM-score: 44.5)
    AAA_5; AAA domain (dynein-related subfamily) (PF07728; HMM-score: 27.6)
    RuvB_N; Holliday junction DNA helicase ruvB N-terminus (PF05496; HMM-score: 25.7)
    AAA_3; ATPase family associated with various cellular activities (AAA) (PF07726; HMM-score: 24.4)
    AAA_14; AAA domain (PF13173; HMM-score: 22.2)
    AAA_16; AAA ATPase domain (PF13191; HMM-score: 19.8)
    RNA_helicase; RNA helicase (PF00910; HMM-score: 19.5)
    AAA_22; AAA domain (PF13401; HMM-score: 19.2)
    AAA_18; AAA domain (PF13238; HMM-score: 19.1)
    NB-ARC; NB-ARC domain (PF00931; HMM-score: 15.7)
    AAA_24; AAA domain (PF13479; HMM-score: 15)
    ABC_tran; ABC transporter (PF00005; HMM-score: 14.9)
    IstB_IS21; IstB-like ATP binding protein (PF01695; HMM-score: 14.6)
    AAA_17; AAA domain (PF13207; HMM-score: 14.2)
    TsaE; Threonylcarbamoyl adenosine biosynthesis protein TsaE (PF02367; HMM-score: 14)
    Zeta_toxin; Zeta toxin (PF06414; HMM-score: 13.5)
    AAA_33; AAA domain (PF13671; HMM-score: 13.1)
    ATPase_2; ATPase domain predominantly from Archaea (PF01637; HMM-score: 13)
    no clan definedDUF4795; Domain of unknown function (DUF4795) (PF16043; HMM-score: 12.8)
    P-loop_NTPase (CL0023) AAA_19; AAA domain (PF13245; HMM-score: 12.5)
    RsgA_GTPase; RsgA GTPase (PF03193; HMM-score: 12.2)
    AAA_25; AAA domain (PF13481; HMM-score: 12.1)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 9.97
    • Cytoplasmic Membrane Score: 0
    • Cellwall Score: 0.01
    • Extracellular Score: 0.02
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.093
    • Ymax_pos: 22
    • Cmax: 0.128
    • Cmax_pos: 22
    • Smax: 0.114
    • Smax_pos: 19
    • Smean: 0.061
    • D: 0.08
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MEIHVYTGPLCGFNEYINSEVKEYHRFMELIREYNIIVRASDTFGTHDVDGIFDTEIENLVIFSNDFASVTTHVITNFINIVTLGRNIKKIYIQNPPKRVFQSLNSFHDSEIIEINYEYTTLKKDDVINFYKEQMAGSKIIGQTDAKKQMSIDLYKHTSLENNKPTVMLYYGPSGVGKTELAKEIAKKYKGNITRIQFSMMQNDESFNYIFGDEHAKVSLSKDLVDRETNVVLIDEFDKVLPIYYNVFYQMFDEGIIEDANYKVDVSNCIFILTSNFNSIEEAIVNIGEPVFSRIDSCIKFLYLTQEEKQKVIENKLNEILSSLNEKEKRIVTAYNLLEKYKETEIDIDNIRYLKKIITNDIYTIIFEDELFNTDIID

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]