From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2168 [new locus tag: NWMN_RS12535 ]
  • pan locus tag?: SAUPAN005729000
  • symbol: moaA
  • pan gene symbol?: moaA
  • synonym:
  • product: molybdenum cofactor biosynthesis protein A

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2168 [new locus tag: NWMN_RS12535 ]
  • symbol: moaA
  • product: molybdenum cofactor biosynthesis protein A
  • replicon: chromosome
  • strand: -
  • coordinates: 2393772..2394794
  • length: 1023
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    841
    901
    961
    1021
    ATGGTAGAACAAATAAAAGATAAACTAGGACGTCCCATCCGTGACTTACGGTTATCTGTG
    ACAGATCGGTGTAACTTTAGGTGTGATTATTGCATGCCTAAAGAGGTATTTGGAGATGAT
    TTCGTATTTTTACCTAAAAATGAACTTTTAACGTTTGATGAAATGGCTAGAATCGCTAAG
    GTATATGCAGAATTAGGTGTAAAAAAAATACGCATTACAGGTGGAGAACCATTGATGCGA
    CGGGATTTAGATGTACTTATAGCTAAATTAAATCAAATCGATGGTATTGAAGATATTGGT
    TTGACTACAAATGGTTTGTTATTAAAAAAGCATGGACAAAAGTTATATGATGCTGGGCTG
    CGCAGAATTAATGTCAGTTTGGATGCTATTGATGATACGCTATTTCAATCAATCAATAAT
    CGTAATATTAAAGCGACTACGATTTTAGAACAAATTGATTACGCGACGTCTATTGGTTTG
    AATGTAAAAGTAAATGTTGTTATACAAAAAGGTATTAACGATGATCAAATCATACCAATG
    CTTGAATATTTTAAAGATAAACATATAGAGATTCGATTTATAGAATTTATGGATGTTGGT
    AATGATAATGGATGGGATTTCAGTAAAGTTGTAACTAAAGATGAAATGCTTACAATGATA
    GAGCAGCACTTTGAAATCGATCCTGTAGAACCAAAATATTTTGGGGAAGTAGCAAAATAT
    TATCGCCATAAGGATAATGGTGTTCAATTTGGTTTGATTACAAGTGTTTCACAATCATTT
    TGTTCTACATGTACACGCGCAAGGCTGTCATCAGATGGGAAGTTTTACGGATGTTTATTT
    GCAACTGTCGATGGATTTAACGTTAAAGCGTTTATTCGTTCTGGCGTGACCGACGAAGAA
    TTAAAAGAACAATTTAAAGCTTTATGGCAAATAAGAGATGATCGATATTCAGATGAGAGA
    ACTGCTCAAACAGTTGCCAATCGTCAACGTAAAAAGATAAACATGAATTATATTGGTGGT
    TAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840
    900
    960
    1020
    1023

Protein[edit source | edit]

Protein Data Bank: 1TV7
Protein Data Bank: 1TV8
Protein Data Bank: 2FB2
Protein Data Bank: 2FB3

General[edit source | edit]

  • locus tag: NWMN_2168 [new locus tag: NWMN_RS12535 ]
  • symbol: MoaA
  • description: molybdenum cofactor biosynthesis protein A
  • length: 340
  • theoretical pI: 6.53074
  • theoretical MW: 39077.6
  • GRAVY: -0.343529

Function[edit source | edit]

  • reaction:
    EC 4.1.99.18?  ExPASy
    Cyclic pyranopterin phosphate synthaseGTP = cyclic pyranopterin phosphate + diphosphate
  • TIGRFAM:
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMolybdopterinmolybdenum cofactor biosynthesis protein A (TIGR02666; HMM-score: 402.8)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersMolybdopterinprobable molybdenum cofactor biosynthesis protein A (TIGR02668; HMM-score: 233.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOthercoenzyme PQQ biosynthesis enzyme PqqE (TIGR02109; HMM-score: 61.3)
    tungsten cofactor oxidoreducase radical SAM maturase (TIGR04317; HMM-score: 59.1)
    pseudo-rSAM protein/SPASM domain protein (TIGR04347; HMM-score: 52.2)
    putative metalloenzyme radical SAM/SPASM domain maturase (TIGR04311; HMM-score: 51.9)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminheme b synthase (TIGR04545; EC 1.3.99.-; HMM-score: 48.9)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminputative heme d1 biosynthesis radical SAM protein NirJ2 (TIGR04055; EC 1.3.99.-; HMM-score: 46.8)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalamin12,18-didecarboxysiroheme deacetylase (TIGR04546; HMM-score: 46.7)
    radical SAM enzyme, rSAM/lipoprotein system (TIGR04133; HMM-score: 44.9)
    GeoRSP system radical SAM/SPASM protein (TIGR04303; HMM-score: 43.1)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminheme d1 biosynthesis radical SAM protein NirJ (TIGR04051; HMM-score: 41.8)
    Cellular processesCellular processesToxin production and resistancecytosylglucuronate decarboxylase (TIGR04466; EC 4.1.-.-; HMM-score: 41.8)
    Unknown functionEnzymes of unknown specificityradical SAM protein, BA_1875 family (TIGR04053; HMM-score: 41.2)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersHeme, porphyrin, and cobalaminputative heme d1 biosynthesis radical SAM protein NirJ1 (TIGR04054; HMM-score: 41)
    hopanoid biosynthesis associated radical SAM protein HpnH (TIGR03470; HMM-score: 40.6)
    SynChlorMet cassette radical SAM/SPASM protein ScmF (TIGR04251; HMM-score: 35.5)
    peptide-modifying radical SAM enzyme CbpB (TIGR04163; HMM-score: 34)
    radical SAM protein, TatD family-associated (TIGR04038; HMM-score: 33.7)
    radical SAM peptide maturase, GG-Bacteroidales family (TIGR04148; HMM-score: 33.1)
    SynChlorMet cassette radical SAM/SPASM protein ScmE (TIGR04250; HMM-score: 33)
    Unknown functionEnzymes of unknown specificityarchaeal radical SAM protein, PTO1314 family (TIGR03961; HMM-score: 32.8)
    antiviral radical SAM protein viperin (TIGR04278; HMM-score: 32.4)
    Genetic information processingProtein synthesistRNA and rRNA base modificationputative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR03963; HMM-score: 32.3)
    nif11-class peptide radical SAM maturase 3 (TIGR04103; HMM-score: 31.9)
    Unknown functionEnzymes of unknown specificityY_X(10)_GDL-associated radical SAM protein (TIGR03913; HMM-score: 30.1)
    His-Xaa-Ser system radical SAM maturase HxsC (TIGR03977; HMM-score: 30.1)
    radical SAM/SPASM domain protein, FxsB family (TIGR04269; HMM-score: 30.1)
    Unknown functionEnzymes of unknown specificitymycofactocin radical SAM maturase (TIGR03962; HMM-score: 29.8)
    arginine 2,3-aminomutase (TIGR04468; EC 5.4.3.-; HMM-score: 29.7)
    Genetic information processingProtein fateProtein modification and repairanaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 29)
    MetabolismPurines, pyrimidines, nucleosides, and nucleotides2'-Deoxyribonucleotide metabolismanaerobic ribonucleoside-triphosphate reductase activating protein (TIGR02495; EC 1.97.-.-; HMM-score: 29)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersBiotinbiotin synthase (TIGR00433; EC 2.8.1.6; HMM-score: 26.4)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOthernitrogenase cofactor biosynthesis protein NifB (TIGR01290; HMM-score: 26.3)
    MetabolismCentral intermediary metabolismNitrogen fixationnitrogenase cofactor biosynthesis protein NifB (TIGR01290; HMM-score: 26.3)
    radical SAM/Cys-rich domain protein (TIGR04167; HMM-score: 26.3)
    Cellular processesCellular processesToxin production and resistanceCys-rich peptide radical SAM maturase CcpM (TIGR04068; HMM-score: 25.5)
    sporulation killing factor system radical SAM maturase (TIGR04403; HMM-score: 24.5)
    Genetic information processingProtein fateProtein modification and repairKxxxW cyclic peptide radical SAM maturase (TIGR04080; HMM-score: 24.4)
    Cellular processesCellular processesAdaptations to atypical conditionsKamA family protein (TIGR00238; HMM-score: 23.7)
    Cellular processesCellular processesBiosynthesis of natural productsSCIFF radical SAM maturase (TIGR03974; HMM-score: 23.6)
    radical SAM/SPASM domain protein, ACGX system (TIGR04340; HMM-score: 23.6)
    pseudo-rSAM protein, GG-Bacteroidales system (TIGR04150; HMM-score: 21.4)
    lysine-2,3-aminomutase-related protein (TIGR03822; EC 5.4.3.-; HMM-score: 21)
    radical SAM enzyme, TIGR04100 family (TIGR04100; HMM-score: 20.6)
    putative peptide-modifying radical SAM enzyme, AF0577 family (TIGR04084; HMM-score: 20.2)
    putative 7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR04349; HMM-score: 18.9)
    Genetic information processingProtein synthesistRNA and rRNA base modification7-cyano-7-deazaguanosine (preQ0) biosynthesis protein QueE (TIGR03365; HMM-score: 18.7)
    Unknown functionEnzymes of unknown specificityradical SAM/CxCxxxxC motif protein YfkAB (TIGR04478; HMM-score: 18.1)
    Genetic information processingProtein synthesistRNA and rRNA base modificationwyosine biosynthesis protein TYW1 (TIGR03972; HMM-score: 17.6)
    radical SAM/SPASM domain peptide maturase, XyeB family (TIGR04496; HMM-score: 17.2)
    Genetic information processingProtein fateProtein modification and repairEF-P beta-lysylation protein EpmB (TIGR03821; EC 5.4.3.-; HMM-score: 16.8)
    lysine-2,3-aminomutase (TIGR03820; EC 5.4.3.2; HMM-score: 16.6)
    putative radical SAM enzyme, TIGR03279 family (TIGR03279; HMM-score: 16.5)
    Genetic information processingProtein fateProtein modification and repairanaerobic sulfatase maturase (TIGR03942; EC 1.1.99.-; HMM-score: 16)
    Cellular processesCellular processesToxin production and resistancenif11-like peptide radical SAM maturase (TIGR04064; HMM-score: 15.6)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairDNA repair protein rad18 (TIGR00599; HMM-score: 15.4)
    Genetic information processingProtein fateProtein modification and repairquinohemoprotein amine dehydrogenase maturation protein (TIGR03906; HMM-score: 14.1)
    radical SAM/SPASM domain protein maturase (TIGR04463; HMM-score: 14)
    His-Xaa-Ser system radical SAM maturase HxsB (TIGR03978; HMM-score: 13.4)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOther7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofH subunit (TIGR03551; EC 2.5.1.77; HMM-score: 12)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOther7,8-didemethyl-8-hydroxy-5-deazariboflavin synthase, CofG subunit (TIGR03550; EC 2.5.1.77; HMM-score: 11.3)
    MetabolismBiosynthesis of cofactors, prosthetic groups, and carriersOtherhomocitrate synthase (TIGR02660; EC 2.3.3.14; HMM-score: 11)
    MetabolismCentral intermediary metabolismNitrogen fixationhomocitrate synthase (TIGR02660; EC 2.3.3.14; HMM-score: 11)
  • TheSEED:  
    Cofactors, Vitamins, Prosthetic Groups, PigmentsFolate and pterinesMolybdenum cofactor biosynthesis Cyclic pyranopterin phosphate synthase (MoaA) (EC 4.1.99.18) 
  • PFAM:
    no clan definedMob_synth_C; Molybdenum Cofactor Synthesis C (PF06463; HMM-score: 131.4)
    TIM_barrel (CL0036) Radical_SAM; Radical SAM superfamily (PF04055; HMM-score: 90.9)
    4Fe-4S (CL0344) Fer4_14; 4Fe-4S single cluster domain (PF13394; HMM-score: 30.6)
    Fer4_12; 4Fe-4S single cluster domain (PF13353; HMM-score: 30.3)
    no clan definedDUF520; Protein of unknown function (DUF520) (PF04461; HMM-score: 13.4)
    DNA_primase_lrg (CL0242) DNA_primase_lrg; Eukaryotic and archaeal DNA primase, large subunit (PF04104; HMM-score: 12.3)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors: S-adenosyl-L-methionine, [4Fe-4S] cluster
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.112
    • Ymax_pos: 12
    • Cmax: 0.114
    • Cmax_pos: 39
    • Smax: 0.172
    • Smax_pos: 3
    • Smean: 0.126
    • D: 0.117
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MVEQIKDKLGRPIRDLRLSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAKVYAELGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGLRRINVSLDAIDDTLFQSINNRNIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPMLEYFKDKHIEIRFIEFMDVGNDNGWDFSKVVTKDEMLTMIEQHFEIDPVEPKYFGEVAKYYRHKDNGVQFGLITSVSQSFCSTCTRARLSSDGKFYGCLFATVDGFNVKAFIRSGVTDEELKEQFKALWQIRDDRYSDERTAQTVANRQRKKINMNYIGG

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]