From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005729000
  • symbol?: moaA
  • description?: molybdenum cofactor biosynthesis protein A

      descriptions from strain specific annotations:

    • molybdenum cofactor biosynthesis protein A
    • cyclic pyranopterin monophosphate synthase
    • Molybdenum cofactor biosynthesis protein MoaA
    • putative molybdenum cofactor biosynthesis protein A
  • strand?: -
  • coordinates?: 5830840..5831769
  • synteny block?: BlockID0044750
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2261 (moaA)
    N315:
    SA2063 (moaA)
    NCTC8325:
    Newman:
    NWMN_2168 (moaA)
    USA300_FPR3757:
    04-02981:
    SA2981_2206 (moaA)
    08BA02176:
    C248_2306 (moaA)
    11819-97:
    MS7_2287 (moaA)
    71193:
    ST398NM01_2319
    ECT-R 2:
    ECTR2_2129 (moaA)
    ED133:
    SAOV_2307c
    ED98:
    SAAV_2331 (moaA)
    HO 5096 0412:
    SAEMRSA15_21660 (moaA)
    JH1:
    SaurJH1_2335
    JH9:
    SaurJH9_2293
    JKD6008:
    SAA6008_02305
    JKD6159:
    SAA6159_02173
    LGA251:
    SARLGA251_20520 (moaA)
    M013:
    M013TW_2226
    MRSA252:
    SAR2352 (moaA)
    MSHR1132:
    SAMSHR1132_20930
    MSSA476:
    SAS2158
    Mu3:
    SAHV_2252 (moaA)
    Mu50:
    SAV2268 (moaA)
    MW2:
    MW2186 (moaA)
    RF122:
    SAB2140c (moaA)
    ST398:
    SAPIG2319 (moaA)
    T0131:
    SAT0131_02445
    TCH60:
    HMPREF0772_10930 (moaA)
    TW20:
    SATW20_24000 (moaA)
    USA300_TCH1516:
    USA300HOU_2250 (moaA)
    VC40:
    SAVC_10205

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVEQIKDKLGRPIRDLRLSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAK
    N315            MVEQIKDKLGRPIRDLRLSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAK
    NCTC8325        MVEQIKDKLGRPIRDLRLSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAK
    Newman          MVEQIKDKLGRPIRDLRLSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAK
    USA300_FPR3757  MVEQIKDKLGRPIRDLRLSVTDRCNFRCDYCMPKEVFGDDFVFLPKNELLTFDEMARIAK
                    ************************************************************

    COL             VYAELGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGL
    N315            VYAELGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGL
    NCTC8325        VYAELGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGL
    Newman          VYAELGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGL
    USA300_FPR3757  VYAELGVKKIRITGGEPLMRRDLDVLIAKLNQIDGIEDIGLTTNGLLLKKHGQKLYDAGL
                    ************************************************************

    COL             RRINVSLDAIDDTLFQSINNRNIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPM
    N315            RRINVSLDAIDDTLFQSINNRNIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPM
    NCTC8325        RRINVSLDAIDDTLFQSINNRNIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPM
    Newman          RRINVSLDAIDDTLFQSINNRNIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPM
    USA300_FPR3757  RRINVSLDAIDDTLFQSINNRNIKATTILEQIDYATSIGLNVKVNVVIQKGINDDQIIPM
                    ************************************************************

    COL             LEYFKDKHIEIRFIEFMDVGNDNGWDFSKVVTKDEMLTMIEQHFEIDPVEPKYFGEVAKY
    N315            LEYFKDKHIEIRFIEFMDVGNDNGWDFSKVVTKDEMLTMIEQHFEIDPVEPKYFGEVAKY
    NCTC8325        LEYFKDKHIEIRFIEFMDVGNDNGWDFSKVVTKDEMLTMIEQHFEIDPVEPKYFGEVAKY
    Newman          LEYFKDKHIEIRFIEFMDVGNDNGWDFSKVVTKDEMLTMIEQHFEIDPVEPKYFGEVAKY
    USA300_FPR3757  LEYFKDKHIEIRFIEFMDVGNDNGWDFSKVVTKDEMLTMIEQHFEIDPVEPKYFGEVAKY
                    ************************************************************

    COL             YRHKDNGVQFGLITSVSQSFCSTCTRARLSSDGKFYGCLFATVDGFNVKAFIRSGVTDEE
    N315            YRHKDNGVQFGLITSVSQSFCSTCTRARLSSDGKFYGCLFATVDGFNVKAFIRSGVTDEE
    NCTC8325        YRHKDNGVQFGLITSVSQSFCSTCTRARLSSDGKFYGCLFATVDGFNVKAFIRSGVTDEE
    Newman          YRHKDNGVQFGLITSVSQSFCSTCTRARLSSDGKFYGCLFATVDGFNVKAFIRSGVTDEE
    USA300_FPR3757  YRHKDNGVQFGLITSVSQSFCSTCTRARLSSDGKFYGCLFATVDGFNVKAFIRSGVTDEE
                    ************************************************************

    COL             LKEQFKALWQIRDDRYSDERTAQTVANRQRKKINMNYIGG
    N315            LKEQFKALWQIRDDRYSDERTAQTVANRQRKKINMNYIGG
    NCTC8325        LKEQFKALWQIRDDRYSDERTAQTVANRQRKKINMNYIGG
    Newman          LKEQFKALWQIRDDRYSDERTAQTVANRQRKKINMNYIGG
    USA300_FPR3757  LKEQFKALWQIRDDRYSDERTAQTVANRQRKKINMNYIGG
                    ****************************************