From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2207 [new locus tag: NWMN_RS12735 ]
  • pan locus tag?: SAUPAN005782000
  • symbol: NWMN_2207
  • pan gene symbol?:
  • synonym:
  • product: N-acetylmuramoyl-L-alanine amidase

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2207 [new locus tag: NWMN_RS12735 ]
  • symbol: NWMN_2207
  • product: N-acetylmuramoyl-L-alanine amidase
  • replicon: chromosome
  • strand: -
  • coordinates: 2427775..2428551
  • length: 777
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    ATGAAGAAGAATTTCAAGTTACGCATTTCAACGCTACTATTGATAGTTATTTTAGTTGTT
    TTTGCTGTATTACTCATCGTGAATGAAACTAAATTGTTTAAAAATGATGTGAATTACTCT
    TTTGATGAGGCTGTTTCAATGCAACAAGGGAAAGGTATTGTACAGACAAAAGAAGAGGAT
    GGTAAATTTGTTGAAGCAAATAATAATGAAATTGCTAAAGCAATGACTATTTCACATAAA
    GACAATGATATGAAGTATATGGATATCACAGAAAAAGTGCCAATGTCGGAATCTGAAGTT
    AACCAATTGCTAAAAGGTAAGGGGATTTTAGAAAATCGAGGGAAAGTTTTTCTAGAAGCT
    CAAGAAAAATATGAGGTTAATGTCATTTATCTTGTTAGCCATGCATTAGTAGAAACAGGT
    AACGGCAAATCAGAATTAGCAAAAGGCATTAAAGATGGGAAAAAACGCTATTACAACTTT
    TTTGGTATAGGAGCATTCGATAGTAGTGCTGTTCGTAGTGGGAAAAGTTATGCTGAAAAG
    GAACAATGGACATCACCAGATAAGGCGATTATTGGTGGTGCAAAGTTCATTCGTAATGAA
    TATTTTGAAAACAATCAACTGAATTTATATCAAATGCGATGGAATCCAGAAAATCCTGCG
    CAACATCAATATGCGAGTGACATTCGCTGGGCAGATAAAATTGCCAAATTAATGGATAAA
    TCCTATAAGCAGTTTGGTATAAAGAAAGATGATATTAGACAAACATATTATAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    777

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2207 [new locus tag: NWMN_RS12735 ]
  • symbol: NWMN_2207
  • description: N-acetylmuramoyl-L-alanine amidase
  • length: 258
  • theoretical pI: 9.60613
  • theoretical MW: 29671.8
  • GRAVY: -0.555039

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
  • TheSEED:  
    Adhesins in Staphylococcus Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96) 
    Biofilm formation in Staphylococcus Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96) 
    Murein Hydrolases Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96) 
    Recycling of Peptidoglycan Amino Acids Bifunctional autolysin Atl / N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28) / Endo-beta-N-acetylglucosaminidase (EC 3.2.1.96) 
  • PFAM:
    Lysozyme (CL0037) Glucosaminidase; Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase (PF01832; HMM-score: 63.7)
    no clan definedDcc1; Sister chromatid cohesion protein Dcc1 (PF09724; HMM-score: 16.7)
    Sigma_reg_N; Sigma factor regulator N-terminal (PF13800; HMM-score: 13)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.09
    • Cellwall Score: 0.18
    • Extracellular Score: 9.73
    • Internal Helix: 1
  • LocateP: N-terminally anchored (No CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: 0.17
    • Signal Peptide Possibility: 0
    • N-terminally Anchored Score: 7
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: Signal peptide length 11 aa
    • Ymax: 0.269
    • Ymax_pos: 11
    • Cmax: 0.128
    • Cmax_pos: 40
    • Smax: 0.808
    • Smax_pos: 3
    • Smean: 0.734
    • D: 0.45
  • predicted transmembrane helices (TMHMM): 1

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKNFKLRISTLLLIVILVVFAVLLIVNETKLFKNDVNYSFDEAVSMQQGKGIVQTKEEDGKFVEANNNEIAKAMTISHKDNDMKYMDITEKVPMSESEVNQLLKGKGILENRGKVFLEAQEKYEVNVIYLVSHALVETGNGKSELAKGIKDGKKRYYNFFGIGAFDSSAVRSGKSYAEKEQWTSPDKAIIGGAKFIRNEYFENNQLNLYQMRWNPENPAQHQYASDIRWADKIAKLMDKSYKQFGIKKDDIRQTYYK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]