From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005782000
  • symbol?:
  • description?: autolysin E

      descriptions from strain specific annotations:

    • autolysin E
    • mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase
    • N-acetylmuramoyl-L-alanine amidase
    • mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase family protein
    • putative N-acetylmuramoyl-L-alanine amidase
    • mannosyl-glycoendo-beta-N-acetylglucosaminidase family protein
    • bifunctional autolysin
    • peptidoglycan endo-beta-N-acetylglucosaminidase
  • strand?: -
  • coordinates?: 5869017..5869655
  • synteny block?: BlockID0045270
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2245
    08BA02176:
    C248_2348
    11819-97:
    MS7_2324
    71193:
    ST398NM01_2357
    ECT-R 2:
    ECTR2_2166
    ED133:
    SAOV_2346c
    ED98:
    SAAV_2368
    HO 5096 0412:
    SAEMRSA15_22040
    JH1:
    SaurJH1_2373
    JH9:
    SaurJH9_2330
    JKD6008:
    SAA6008_02342 (lytA)
    JKD6159:
    SAA6159_02210 (lytA)
    LGA251:
    SARLGA251_20890
    M013:
    M013TW_2263
    MRSA252:
    SAR2391
    MSHR1132:
    SAMSHR1132_21310
    MSSA476:
    SAS2198
    Mu3:
    SAHV_2291
    Mu50:
    SAV2307
    MW2:
    MW2226
    RF122:
    SAB2183c
    ST398:
    SAPIG2357
    T0131:
    SAT0131_02485 (mutS2)
    TCH60:
    HMPREF0772_10889 (amiD3)
    TW20:
    SATW20_24370
    USA300_TCH1516:
    USA300HOU_2288 (lytA)
    VC40:
    SAVC_10390

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKNFKLRISTLLLIVILVVFAVLLIVNETKLFKNDVNYSFDEAVSMQQGKGIVQTKEED
    N315            MKKNFKLRISTLLLIVILVVFAVLLIVNETKLFKNDVNYSFDEAVSMQQGKGIVQTKEED
    NCTC8325        ----------------------------------------------MQQGKGIVQTKEED
    Newman          MKKNFKLRISTLLLIVILVVFAVLLIVNETKLFKNDVNYSFDEAVSMQQGKGIVQTKEED
    USA300_FPR3757  MKKNFKLRISTLLLIVILVVFAVLLIVNETKLFKNDVNYSFDEAVSMQQGKGIVQTKEED
                                                                  **************

    COL             GKFVEANNNEIAKAMTISHKDNDMKYMDITEKVPMSESEVNQLLKGKGILENRGKVFLEA
    N315            GKFVEANNNEIAKAMTISHKDNDMKYMDITEKVPMSESEVNQLLKGKGILENRGKVFLEA
    NCTC8325        GKFVEANNNEIAKAMTISHKDNDMKYMDITEKVPMSESEVNQLLKGKGILENRGKVFLEA
    Newman          GKFVEANNNEIAKAMTISHKDNDMKYMDITEKVPMSESEVNQLLKGKGILENRGKVFLEA
    USA300_FPR3757  GKFVEANNNEIAKAMTISHKDNDMKYMDITEKVPMSESEVNQLLKGKGILENRGKVFLEA
                    ************************************************************

    COL             QEKYEVNVIYLVSHALVETGNGKSELAKGIKDGKKRYYNFFGIGAFDSSAVRSGKSYAEK
    N315            QEKYEVNVIYLVSHALVETGNGKSELAKGIKDGKKRYYNFFGIGAFDSSAVRSGKSYAEK
    NCTC8325        QEKYEVNVIYLVSHALVETGNGKSELAKGIKDGKKRYYNFFGIGAFDSSAVRSGKSYAEK
    Newman          QEKYEVNVIYLVSHALVETGNGKSELAKGIKDGKKRYYNFFGIGAFDSSAVRSGKSYAEK
    USA300_FPR3757  QEKYEVNVIYLVSHALVETGNGKSELAKGIKDGKKRYYNFFGIGAFDSSAVRSGKSYAEK
                    ************************************************************

    COL             EQWTSPDKAIIGGAKFIRNEYFENNQLNLYQMRWNPENPAQHQYASDIRWADKIAKLMDK
    N315            EQWTSPDKAIIGGAKFIRNEYFENNQLNLYQMRWNPENPAQHQYASDIRWADKIAKLMDK
    NCTC8325        EQWTSPDKAIIGGAKFIRNEYFENNQLNLYQMRWNPENPAQHQYASDIRWADKIAKLMDK
    Newman          EQWTSPDKAIIGGAKFIRNEYFENNQLNLYQMRWNPENPAQHQYASDIRWADKIAKLMDK
    USA300_FPR3757  EQWTSPDKAIIGGAKFIRNEYFENNQLNLYQMRWNPENPAQHQYASDIRWADKIAKLMDK
                    ************************************************************

    COL             SYKQFGIKKDDIRQTYYK
    N315            SYKQFGIKKDDIRQTYYK
    NCTC8325        SYKQFGIKKDDIRQTYYK
    Newman          SYKQFGIKKDDIRQTYYK
    USA300_FPR3757  SYKQFGIKKDDIRQTYYK
                    ******************