From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002179000
  • symbol?: sle1
  • description?: N-acetylmuramoyl-L-alanine amidase

      descriptions from strain specific annotations:

    • N-acetylmuramoyl-L-alanine amidase
    • CHAP domain-containing protein
    • N-acetylmuramyl-L-alanine amidase Sle1
    • LysM domain-containing protein
    • Autolysin precursor
    • muramidase-2 (1,4-beta-N-acetylmuramoylhydrolase) (Peptidoglycan hydrolase) (Pg-hydrolase 2)(Lysozyme)
    • N-acetylmuramoyl-L-alanine amidase sle1
    • CHAP domain-contain protein
    • autolysin
    • N-acetylmuramoyl-L-alanine amidase AAA precursor
    • LysM family autolysin
    • endopeptidase lytE
  • strand?: +
  • coordinates?: 2683227..2684554
  • synteny block?: BlockID0014800
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0440
    08BA02176:
    C248_0514
    11819-97:
    MS7_0438
    71193:
    ST398NM01_0530
    ECT-R 2:
    ECTR2_398
    ED133:
    SAOV_0482
    ED98:
    SAAV_0407
    HO 5096 0412:
    SAEMRSA15_03900
    JH1:
    SaurJH1_0499
    JH9:
    SaurJH9_0486
    JKD6008:
    SAA6008_00468
    JKD6159:
    SAA6159_00414
    LGA251:
    SARLGA251_03980
    M013:
    M013TW_0429
    MRSA252:
    SAR0464
    MSHR1132:
    SAMSHR1132_04090
    MSSA476:
    SAS0422
    Mu3:
    SAHV_0462 (sle1)
    Mu50:
    SAV0465
    MW2:
    MW0419
    RF122:
    SAB0414
    ST398:
    SAPIG0530
    T0131:
    SAT0131_00505
    TCH60:
    HMPREF0772_10058 (amiD)
    TW20:
    SATW20_05330
    USA300_TCH1516:
    USA300HOU_0465
    VC40:
    SAVC_01910

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MQKKVIAAIIGTSAISAVAATQANAATTHTVKPGESVWAISNKYGISIAKLKSLNNLTSN
    N315            MQKKVIAAIIGTSAISAVAATQANAATTHTVKPGESVWAISNKYGISIAKLKSLNNLTSN
    NCTC8325        MQKKVIAAIIGTSAISAVAATQANAATTHTVKPGESVWAISNKYGISIAKLKSLNNLTSN
    Newman          MQKKVIAAIIGTSAISAVAATQANAATTHTVKPGESVWAISNKYGISIAKLKSLNNLTSN
    USA300_FPR3757  MQKKVIAAIIGTSAISAVAATQANAATTHTVKPGESVWAISNKYGISIAKLKSLNNLTSN
                    ************************************************************

    COL             LIFPNQVLKVSGSSNSTSNSSRPSTNSGGGSYYTVQAGDSLSLIASKYGTTYQNIMRLNG
    N315            LIFPNQVLKVSGSSNSTSNSSRPSTNSGGGSYYTVQAGDSLSLIASKYGTTYQNIMRLNG
    NCTC8325        LIFPNQVLKVSGSSNSTSNSSRPSTNSGGGSYYTVQAGDSLSLIASKYGTTYQNIMRLNG
    Newman          LIFPNQVLKVSGSSNSTSNSSRPSTNSGGGSYYTVQAGDSLSLIASKYGTTYQNIMRLNG
    USA300_FPR3757  LIFPNQVLKVSGSSNSTSNSSRPSTNSGGGSYYTVQAGDSLSLIASKYGTTYQNIMRLNG
                    ************************************************************

    COL             LNNFFIYPGQKLKVSGTASSSNAASNSSRPSTNSGGGSYYTVQAGDSLSLIASKYGTTYQ
    N315            LNNFFIYPGQKLKVSGTASSSNAASNSSRPSTNSGGGSYYTVQAGDSLSLIASKYGTTYQ
    NCTC8325        LNNFFIYPGQKLKVSGTASSSNAASNSSRPSTNSGGGSYYTVQAGDSLSLIASKYGTTYQ
    Newman          LNNFFIYPGQKLKVSGTASSSNAASNSSRPSTNSGGGSYYTVQAGDSLSLIASKYGTTYQ
    USA300_FPR3757  LNNFFIYPGQKLKVSGTASSSNAASNSSRPSTNSGGGSYYTVQAGDSLSLIASKYGTTYQ
                    ************************************************************

    COL             KIMSLNGLNNFFIYPGQKLKVTGNASTNSGSATTTNRGYNTPVFSHQNLYTWGQCTYHVF
    N315            KIMSLNGLNNFFIYPGQKLKVTGNASTNSGSATTTNRGYNTPVFSHQNLYTWGQCTYHVF
    NCTC8325        KIMSLNGLNNFFIYPGQKLKVTGNASTNSGSATTTNRGYNTPVFSHQNLYTWGQCTYHVF
    Newman          KIMSLNGLNNFFIYPGQKLKVTGNASTNSGSATTTNRGYNTPVFSHQNLYTWGQCTYHVF
    USA300_FPR3757  KIMSLNGLNNFFIYPGQKLKVTGNASTNSGSATTTNRGYNTPVFSHQNLYTWGQCTYHVF
                    ************************************************************

    COL             NRRAEIGKGISTYWWNANNWDNAAAADGYTIDNRPTVGSIAQTDVGYYGHVMFVERVNND
    N315            NRRAEIGKGISTYWWNANNWDNAAAADGYTIDNRPTVGSIAQTDVGYYGHVMFVERVNND
    NCTC8325        NRRAEIGKGISTYWWNANNWDNAAAADGYTIDNRPTVGSIAQTDVGYYGHVMFVERVNND
    Newman          NRRAEIGKGISTYWWNANNWDNAAAADGYTIDNRPTVGSIAQTDVGYYGHVMFVERVNND
    USA300_FPR3757  NRRAEIGKGISTYWWNANNWDNAAAADGYTIDNRPTVGSIAQTDVGYYGHVMFVERVNND
                    ************************************************************

    COL             GSILVSEMNYSAAPGILTYRTVPAYQVNNYRYIH
    N315            GSILVSEMNYSAAPGILTYRTVPAYQVNNYRYIH
    NCTC8325        GSILVSEMNYSAAPGILTYRTVPAYQVNNYRYIH
    Newman          GSILVSEMNYSAAPGILTYRTVPAYQVNNYRYIH
    USA300_FPR3757  GSILVSEMNYSAAPGILTYRTVPAYQVNNYRYIH
                    **********************************