From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005767000
  • symbol?: ssaA
  • description?: secretory antigen SsaA-like protein

      descriptions from strain specific annotations:

    • secretory antigen SsaA-like protein
    • CHAP domain-containing protein
    • secretory antigen precursor SsaA-like protein
    • staphyloxanthin biosynthesis protein
    • Secretory antigen precursor SsaA
    • staphylococcal secretory antigen ssaA
    • Secretory antigen precursor SsaA_1
    • secretory antigen precursor SsaA, putative autolysin
    • Staphylococcal secretory antigen ssaA2
    • staphylococcal secretory antigen, Ssa2
  • strand?: +
  • coordinates?: 5858302..5859120
  • synteny block?: BlockID0045130
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA2093 (ssaA)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2237 (ssaA)
    08BA02176:
    C248_2339 (ssaA2)
    11819-97:
    MS7_2317
    71193:
    ST398NM01_2350
    ECT-R 2:
    ECTR2_2159
    ED133:
    SAOV_2339
    ED98:
    SAAV_2361
    HO 5096 0412:
    SAEMRSA15_21960
    JH1:
    SaurJH1_2366
    JH9:
    SaurJH9_2323
    JKD6008:
    SAA6008_02335 (ssaA_1)
    JKD6159:
    SAA6159_02203 (ssa2)
    LGA251:
    SARLGA251_20820
    M013:
    M013TW_2256
    MRSA252:
    SAR2383
    MSHR1132:
    SAMSHR1132_21240
    MSSA476:
    SAS2189
    Mu3:
    SAHV_2283 (ssaA)
    Mu50:
    SAV2299 (ssaA)
    MW2:
    MW2217
    RF122:
    SAB2172
    ST398:
    SAPIG2350
    T0131:
    SAT0131_02478
    TCH60:
    HMPREF0772_10899
    TW20:
    SATW20_24300
    USA300_TCH1516:
    USA300HOU_2280
    VC40:
    SAVC_10355

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKIATATIATAGFATIAIASGNQAHASEQDNYGYNPNDPTSYSYTYTIDAQGNYHYTWK
    N315            MKKIATATIATAGFATIAIASGNQAHASEQDNYGYNPNDPTSYSYTYTIDAQGNYHYTWK
    NCTC8325        MKKIATATIATAGFATIAIASGNQAHASEQDNYGYNPNDPTSYSYTYTIDAQGNYHYTWK
    Newman          MKKIATATIATAGFATIAIASGNQAHASEQDNYGYNPNDPTSYSYTYTIDAQGNYHYTWK
    USA300_FPR3757  MKKIATATIATAGFATIAIASGNQAHASEQDNYGYNPNDPTSYSYTYTIDAQGNYHYTWK
                    ************************************************************

    COL             GNWHPSQLNQDNGYYSYYYYNGYNNYNNYNNGYSYNNYSRYNNYSNNNQSYNYNNYNSYN
    N315            GNWHPSQLNQDNGYYSYYYYNGYNNYNNYNNGYSYNNYSRYNNYSNNNQSYNYNNYNSYN
    NCTC8325        GNWHPSQLNQDNGYYSYYYYNGYNNYNNYNNGYSYNNYSRYNNYSNNNQSYNYNNYNSYN
    Newman          GNWHPSQLNQDNGYYSYYYYNGYNNYNNYNNGYSYNNYSRYNNYSNNNQSYNYNNYNSYN
    USA300_FPR3757  GNWHPSQLNQDNGYYSYYYYNGYNNYNNYNNGYSYNNYSRYNNYSNNNQSYNYNNYNSYN
                    ************************************************************

    COL             TNSYRTGGLGASYSTSSNNVQVTTTMAPSSNGRSISSGYTSGRNLYTSGQCTYYVFDRVG
    N315            TNSYRTGGLGASYSTSSNNVQVTTTMAPSSNGRSISSGYTSGRNLYTSGQCTYYVFDRVG
    NCTC8325        TNSYRTGGLGASYSTSSNNVQVTTTMAPSSNGRSISSGYTSGRNLYTSGQCTYYVFDRVG
    Newman          TNSYRTGGLGASYSTSSNNVQVTTTMAPSSNGRSISSGYTSGRNLYTSGQCTYYVFDRVG
    USA300_FPR3757  TNSYRTGGLGASYSTSSNNVQVTTTMAPSSNGRSISSGYTSGRNLYTSGQCTYYVFDRVG
                    ************************************************************

    COL             GKIGSTWGNASNWANAAARAGYTVNNTPKAGAIMQTTQGAYGHVAYVESVNSNGSVRVSE
    N315            GKIGSTWGNASNWANAAARAGYTVNNTPKAGAIMQTTQGAYGHVAYVESVNSNGSVRVSE
    NCTC8325        GKIGSTWGNASNWANAAARAGYTVNNTPKAGAIMQTTQGAYGHVAYVESVNSNGSVRVSE
    Newman          GKIGSTWGNASNWANAAARAGYTVNNTPKAGAIMQTTQGAYGHVAYVESVNSNGSVRVSE
    USA300_FPR3757  GKIGSTWGNASNWANAAARAGYTVNNTPKAGAIMQTTQGAYGHVAYVESVNSNGSVRVSE
                    ************************************************************

    COL             MNYGYGPGVVTSRTISASQAAGYNFIH
    N315            MNYGYGPGVVTSRTISASQAAGYNFIH
    NCTC8325        MNYGYGPGVVTSRTISASQAAGYNFIH
    Newman          MNYGYGPGVVTSRTISASQAAGYNFIH
    USA300_FPR3757  MNYGYGPGVVTSRTISASQAAGYNFIH
                    ***************************