From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005381000
  • symbol?: sceD
  • description?: transglycosylase SceD

      descriptions from strain specific annotations:

    • transglycosylase SceD
    • sceD protein
    • exported protein
    • putative transglycosylase sceD
    • SceD
    • SceD-like transglycosylase, biomarker for vancomycin-intermediate strains
    • sceD protein, putative
    • transglycosylase domain-containing protein
    • transglycosylase-like domain protein
  • strand?: -
  • coordinates?: 5547900..5548595
  • synteny block?: BlockID0041780
  • occurrence?: in 97% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2036
    08BA02176:
    C248_2109
    11819-97:
    MS7_2112 (sceD)
    71193:
    ST398NM01_2138
    ECT-R 2:
    ECTR2_1952
    ED133:
    SAOV_2137c
    ED98:
    SAAV_2151
    HO 5096 0412:
    SAEMRSA15_20040
    JH1:
    SaurJH1_2170
    JH9:
    SaurJH9_2132
    JKD6008:
    SAA6008_02134 (sceD)
    JKD6159:
    SAA6159_02009 (sceD)
    LGA251:
    SARLGA251_18970 (sceD)
    M013:
    M013TW_2053
    MRSA252:
    SAR2184
    MSHR1132:
    SAMSHR1132_19190
    MSSA476:
    SAS1999
    Mu3:
    SAHV_2080
    Mu50:
    SAV2095
    MW2:
    MW2020
    RF122:
    SAB1980c
    ST398:
    SAPIG2138
    T0131:
    SAT0131_02256
    TCH60:
    HMPREF0772_11096 (sceD)
    TW20:
    SATW20_22340 (sceD)
    USA300_TCH1516:
    VC40:
    SAVC_09355

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKTLLASSLAVGLGIVAGNAGHEAHASEADLNKASLAQMAQSNDQTLNQKPIEAGAYNY
    N315            MKKTLLASSLAVGLGIVAGNAGHEAHASEADLNKASLAQMAQSNDQTLNQKPIEAGAYNY
    NCTC8325        MKKTLLASSLAVGLGIVAGNAGHEAHASEADLNKASLAQMAQSNDQTLNQKPIEAGAYNY
    Newman          MKKTLLASSLAVGLGIVAGNAGHEAHASEADLNKASLAQMAQSNDQTLNQKPIEAGAYNY
    USA300_FPR3757  MKKTLLASSLAVGLGIVAGNAGHEAHASEADLNKASLAQMAQSNDQTLNQKPIEAGAYNY
                    ************************************************************

    COL             TFDYEGFTYHFESDGTHFAWNYHATGTNGADMSAQAPTTNNVAPSAVQANQVQSQEVEAP
    N315            TFDYEGFTYHFESDGTHFAWNYHATGANGANMSAQAPATNNVEPSAVQANQVQSQEVEAP
    NCTC8325        TFDYEGFTYHFESDGTHFAWNYHATGTNGADMSAQAPATNNVAPSAVQANQVQSQEVEAP
    Newman          TFDYEGFTYHFESDGTHFAWNYHATGTNGADMSAQAPATNNVAPSAVQANQVQSQEVEAP
    USA300_FPR3757  TFDYEGFTYHFESDGTHFAWNYHATGTNGADMSAQAPATNNVAPSAVQANQVQSQEVEAP
                    **************************:***:******:**** *****************

    COL             QNAQTQQPQASTSNNSQVTATPTESKSSEGSSVNVNAHLKQIAQRESGGNIHAVNPTSGA
    N315            QNAQTQQPQASTSNNSQVTATPTESKASEGSSVNVNAHLKQIAQRESGGNIHAVNPTSGA
    NCTC8325        QNAQTQQPQASTSNNSQVTATPTESKSSEGSSVNVNAHLKQIAQRESGGNIHAVNPTSGA
    Newman          QNAQTQQPQASTSNNSQVTATPTESKSSEGSSVNVNAHLKQIAQRESGGNIHAVNPTSGA
    USA300_FPR3757  QNAQTQQPQASTSNNSQVTATPTESKSSEGSSVNVNAHLKQIAQRESGGNIHAVNPTSGA
                    **************************:*********************************

    COL             AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGAGHWVTA
    N315            AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGAGHWVTA
    NCTC8325        AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGAGHWVTA
    Newman          AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGAGHWVTA
    USA300_FPR3757  AGKYQFLQSTWDSVAPAKYKGVSPANAPESVQDAAAVKLYNTGGAGHWVTA
                    ***************************************************