From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001174000
  • symbol?:
  • description?: CHAP domain-containing protein

      descriptions from strain specific annotations:

    • CHAP domain-containing protein
    • staphyloxanthin biosynthesis protein
    • putative staphyloxanthin biosynthesis protein
    • Secretory antigen precursor SsaA
    • CHAP domain protein
    • pseudogene
    • Secretory antigen SsaA
    • staphyloxanthin biosynthesis protein, putative
  • strand?: -
  • coordinates?: 1442071..1442882
  • synteny block?: BlockID0006930
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0281 (ssaA)
    08BA02176:
    C248_0271
    11819-97:
    MS7_0272
    71193:
    ST398NM01_0296
    ECT-R 2:
    ECTR2_242
    ED133:
    SAOV_0224
    ED98:
    SAAV_0249
    HO 5096 0412:
    SAEMRSA15_02400
    JH1:
    SaurJH1_0272
    JH9:
    SaurJH9_0265
    JKD6008:
    SAA6008_00255 (sssA)
    JKD6159:
    SAA6159_00262 (sssA)
    LGA251:
    SARLGA251_02450
    M013:
    M013TW_0262
    MRSA252:
    SAR0278
    MSHR1132:
    SAMSHR1132_02490
    MSSA476:
    SAS0257
    Mu3:
    SAHV_0279
    Mu50:
    SAV0281
    MW2:
    MW0257
    RF122:
    SAB0222c
    ST398:
    SAPIG0296
    T0131:
    SAT0131_00277
    TCH60:
    HMPREF0772_10219
    TW20:
    SATW20_02830
    USA300_TCH1516:
    USA300HOU_0296
    VC40:
    SAVC_01155

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             ---MKKTILLTMTTLTLFSMSPNSAQAYTNDSKTLEEAKKAHPNAQFKVNKDTGAYTYTY
    N315            ---MKKTILLTMTTLTLFSMSPNSAQAYTNDSKTLEEAKRAHPNAQFKVNKDTGAYTYTY
    NCTC8325        ---MKKTILLTMTTLTLFSMSPNSAQAYTNDSKTLEEAKKAHPNAQFKVNKDTGAYTYTY
    Newman          MVIMKKTILLTMTTLTLFSMSPNSAQAYTNDSKTLEEAKKAHPNAQFKVNKDTGAYTYTY
    USA300_FPR3757  ---MKKTILLTMTTLTLFSMSPNSAQAYTNDSKTLEEAKKAHPNAQFKVNKDTGAYTYTY
                       ************************************:********************

    COL             DKNNTPNNNHQNQSRTNDNHQHANQRDLNNNQYHSSLSGQYTHINDAIDSHTPPQTSPSN
    N315            DKNNTPNNNHQNQSRTNDNHQHANQRDFNNNQYHSSLSGQYTHINDAIDSHTPPQTSPSN
    NCTC8325        DKNNTPNNNHQNQSRTNDNHQHANQRDLNNNQYHSSLSGQYTHINDAIDSHTPPQTSPSN
    Newman          DKNNTPNNNHQNQSRTNDNHQHANQRDLNNNQYHSSLSGQYTHINDAIDSHTPPQTSPSN
    USA300_FPR3757  DKNNTPNNNHQNQSRTNDNHQHANQRDLNNNQYHSSLSGQYTHINDAIDSHTPPQTSPSN
                    ***************************:********************************

    COL             PLTPAIPNVEDNDDELNNAFSKDNKGLITGIDLDELYDELQIAEFNDKAKTADGKPLALG
    N315            PLTPAIPNVEDNDDELNNAFSKDNKGLITGIDLDELYDELQIAEFNDKAKTADGKPLALG
    NCTC8325        PLTPAIPNVEDNDDELNNAFSKDNKGLITGIDLDELYDELQIAEFNDKAKTADGKPLALG
    Newman          PLTPAIPNVEDNDDELNNAFSKDNKGLITGIDLDELYDELQIAEFNDKAKTADGKPLALG
    USA300_FPR3757  PLTPAIPNVEDNDDELNNAFSKDNKGLITGIDLDELYDELQIAEFNDKAKTADGKPLALG
                    ************************************************************

    COL             NGKIIDQPLITSKNNLYTAGQCTWYVFDKRAKDGHTISTFWGDAKNWAGQASSNGFKVDR
    N315            NGKIIDQPLITSKNNLYTAGQCTWYVFDKRAKDGHTISTFWGDAKNWAGQASSNGFKVDR
    NCTC8325        NGKIIDQPLITSKNNLYTAGQCTWYVFDKRAKDGHTISTFWGDAKNWAGQASSNGFKVDR
    Newman          NGKIIDQPLITSKNNLYTAGQCTWYVFDKRAKDGHTISTFWGDAKNWAGQASSNGFKVDR
    USA300_FPR3757  NGKIIDQPLITSKNNLYTAGQCTWYVFDKRAKDGHTISTFWGDAKNWAGQASSNGFKVDR
                    ************************************************************

    COL             HPTRGSILQTVNGPFGHVAYVEKVNIDGSILISEMNWIGEYIVSSRTISASEVSSYNYIH
    N315            HPTRGSILQTVNGPFGHVAYVEKVNIDGSILISEMNWIGEYIVSSRTISASEVSSYNYIH
    NCTC8325        HPTRGSILQTVNGPFGHVAYVEKVNIDGSILISEMNWIGEYIVSSRTISASEVSSYNYIH
    Newman          HPTRGSILQTVNGPFGHVAYVEKVNIDGSILISEMNWIGEYIVSSRTISASEVSSYNYIH
    USA300_FPR3757  HPTRGSILQTVNGPFGHVAYVEKVNIDGSILISEMNWIGEYIVSSRTISASEVSSYNYIH
                    ************************************************************