From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN004237000
  • symbol?: lytH
  • description?: N-acetylmuramoyl-L-alanine amidase

      descriptions from strain specific annotations:

    • N-acetylmuramoyl-L-alanine amidase
    • cell wall hydrolase/autolysin
    • LytH protein involved in methicillin resistance / N-acetylmuramoyl-L-alanine amidase domain protein
    • N-acetylmuramoyl-L-alanine amidase family protein
    • putative N-acetylmuramoyl-L-alanine amidase
    • cell wall amidase lytH
    • pseudogene
  • strand?: -
  • coordinates?: 4482932..4483744
  • synteny block?: BlockID0032650
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    SA1458 (lytH)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_1590 (lytH)
    08BA02176:
    C248_1675 (lytH)
    11819-97:
    MS7_1647
    71193:
    ST398NM01_1695
    ECT-R 2:
    ECTR2_1480
    ED133:
    SAOV_1629
    ED98:
    SAAV_1625
    HO 5096 0412:
    SAEMRSA15_15490
    JH1:
    SaurJH1_1722
    JH9:
    SaurJH9_1689
    JKD6008:
    SAA6008_01601 (lytH)
    JKD6159:
    SAA6159_01564 (lytH)
    LGA251:
    SARLGA251_15340
    M013:
    M013TW_1652
    MRSA252:
    SAR1712
    MSHR1132:
    SAMSHR1132_14680
    MSSA476:
    SAS1568
    Mu3:
    SAHV_1619 (lytH)
    Mu50:
    SAV1632 (lytH)
    MW2:
    MW1582
    RF122:
    SAB1501c
    ST398:
    SAPIG1695 (lytH)
    T0131:
    SAT0131_01730 (sdrE)
    TCH60:
    HMPREF0772_11510 (amiD5)
    TW20:
    SATW20_16260
    USA300_TCH1516:
    USA300HOU_1630 (lytH)
    VC40:
    SAVC_07405

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKIEAWLSKKGLKNKRTLIVVIAFVLFIIFLFLLLNSNSEDSGNITITENAELRTGPNA
    N315            MKKIEAWLSKKGLKNKRTLIVVIAFVLFIIFLFLLLNSNSEDSGNITITENAELRTGPNA
    NCTC8325        MKKIEAWLSKKGLKNKRTLIVVIAFVLFIIFLFLLLNSNSEDSGNITITENAELRTGPNA
    Newman          MKKIEAWLSKKGLKNKRTLIVVIAFVLFIIFLFLLLNSNSEDSGNITITENAELRTGPNA
    USA300_FPR3757  MKKIEAWLSKKGLKNKRTLIVVIAFVLFIIFLFLLLNSNSEDSGNITITENAELRTGPNA
                    ************************************************************

    COL             AYPVIYKVEKGDHFKKIGKVGKWIEVEDTSSNEKGWIAGWHTNLDIVADNTKEKNPLQGK
    N315            AYPVIYKVEKGDHFKKIGKVGKWIEVEDTSSNEKGWIAGWHTNLDIVADNTKEKNPLQGK
    NCTC8325        AYPVIYKVEKGDHFKKIGKVGKWIEVEDTSSNEKGWIAGWHTNLDIVADNTKEKNPLQGK
    Newman          AYPVIYKVEKGDHFKKIGKVGKWIEVEDTSSNEKGWIAGWHTNLDIVADNTKEKNPLQGK
    USA300_FPR3757  AYPVIYKVEKGDHFKKIGKVGKWIEVEDTSSNEKGWIAGWHTNLDIVADNTKEKNPLQGK
                    ************************************************************

    COL             TIVLDPGHGGSDQGASSNTKYKSLEKDYTLKTAKELQRTLEKEGATVKMTRTDDTYVSLE
    N315            TIVLDPGHGGSDQGASSNTKYKSLEKDYTLKTAKELQRTLEKEGATVKMTRTDDTYVSLE
    NCTC8325        TIVLDPGHGGSDQGASSNTKYKSLEKDYTLKTAKELQRTLEKEGATVKMTRTDDTYVSLE
    Newman          TIVLDPGHGGSDQGASSNTKYKSLEKDYTLKTAKELQRTLEKEGATVKMTRTDDTYVSLE
    USA300_FPR3757  TIVLDPGHGGSDQGASSNTKYKSLEKDYTLKTAKELQRTLEKEGATVKMTRTDDTYVSLE
                    ************************************************************

    COL             NRDIKGDAYLSIHNDALESSNANGMTVYWYHDNQRALADTLDATIQKKGLLSNRGSRQEN
    N315            NRDIKGDAYLSIHNDALESSNANGMTVYWYHDNQRALADTLDATIQKKGLLSNRGSRQEN
    NCTC8325        NRDIKGDAYLSIHNDALESSNANGMTVYWYHDNQRALADTLDATIQKKGLLSNRGSRQEN
    Newman          NRDIKGDAYLSIHNDALESSNANGMTVYWYHDNQRALADTLDATIQKKGLLSNRGSRQEN
    USA300_FPR3757  NRDIKGDAYLSIHNDALESSNANGMTVYWYHDNQRALADTLDATIQKKGLLSNRGSRQEN
                    ************************************************************

    COL             YQVLRQTKVPAVLLELGYISNPTDETMIKDQLHRQILEQAIVDGLKIYFSA
    N315            YQVLRQTKVPAVLLELGYISNPTDETMIKDQLHRQILEQAIVDGLKIYFSA
    NCTC8325        YQVLRQTKVPAVLLELGYISNPTDETMIKDQLHRQILEQAIVDGLKIYFSA
    Newman          YQVLRQTKVPAVLLELGYISNPTDETMIKDQLHRQILEQAIVDGLKIYFSA
    USA300_FPR3757  YQVLRQTKVPAVLLELGYISNPTDETMIKDQLHRQILEQAIVDGLKIYFSA
                    ***************************************************