From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN002669000
  • symbol?:
  • description?: peptidase M23

      descriptions from strain specific annotations:

    • peptidase M23
    • LysM domain-containing protein
    • CHAP domain-containing protein
    • LysM domain protein
    • LysM family autolysin
    • peptidoglycan hydrolysis related protein
    • Secretory antigen
    • secretory antigen ssaA2
    • staphylococcal secretory antigen ssaA
  • strand?: +
  • coordinates?: 3165290..3166129
  • synteny block?: BlockID0019040
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0733 (lysM)
    08BA02176:
    C248_0842
    11819-97:
    MS7_0805
    71193:
    ST398NM01_0831
    ECT-R 2:
    ECTR2_705
    ED133:
    SAOV_0792
    ED98:
    SAAV_0718
    HO 5096 0412:
    SAEMRSA15_06810
    JH1:
    SaurJH1_0796
    JH9:
    SaurJH9_0779
    JKD6008:
    SAA6008_00770
    JKD6159:
    SAA6159_00710
    LGA251:
    SARLGA251_06880
    M013:
    M013TW_0742
    MRSA252:
    SAR0809
    MSHR1132:
    SAMSHR1132_07000
    MSSA476:
    SAS0720
    Mu3:
    SAHV_0752
    Mu50:
    SAV0755
    MW2:
    MW0717
    RF122:
    SAB0708
    ST398:
    SAPIG0831
    T0131:
    SAT0131_00827
    TCH60:
    HMPREF0772_12426
    TW20:
    SATW20_08300
    USA300_TCH1516:
    USA300HOU_0783
    VC40:
    SAVC_03410

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKSLTVTVSSVLAFLALNNAAHAQQHGTQVKTPVQHNYVSNVQAQTQSPTTYTVVAGDS
    N315            MKKTLTVTVSSVLAFLALNNAAHAQQHGTQVKTPVQHNYVSNVQAQTQSPTTYTVVAGDS
    NCTC8325        MKKSLTVTVSSVLAFLALNNAAHAQQHGTQVKTPVQHNYVSNVQAQTQSPTTYTVVAGDS
    Newman          MKKSLTVTVSSVLAFLALNNAAHAQQHGTQVKTPVQHNYVSNVQAQTQSPTTYTVVAGDS
    USA300_FPR3757  MKKSLTVTVSSVLAFLALNNAAHAQQHGTQVKTPVQHNYVSNVQAQTQSPTTYTVVAGDS
                    ***:********************************************************

    COL             LYKIALEHHLTLNQLYSYNPGVTPLIFPGDVISLVPQNKVKQTKAVKSPVRKASQAKKVV
    N315            LYKIALEHHLTLNQLYSYNPGVTPLIFPGDVISLVPQNKVKQTKAVKSPVRKASQAKKVV
    NCTC8325        LYKIALEHHLTLNQLYSYNPGVTPLIFPGDVISLVPQNKVKQTKAVKSPVRKASQAKKVV
    Newman          LYKIALEHHLTLNQLYSYNPGVTPLIFPGDVISLVPQNKVKQTKAVKSPVRKASQAKKVV
    USA300_FPR3757  LYKIALEHHLTLNQLYSYNPGVTPLIFPGDVISLVPQNKVKQTKAVKSPVRKASQAKKVV
                    ************************************************************

    COL             KQPVQQASKKVVVKQAPKQAVTKTVNVAYKPAQVQKSVPTVPVAHNYNKSVANRGNLYAY
    N315            KQPVQQASKKVVVKQAPKQAVAKTVNVAYKPAQVQKSVPTVPVAHNYNKSVANRGNLYAY
    NCTC8325        KQPVQQASKKVVVKQAPKQAVTKTVNVAYKPAQVQKSVPTVPVAHNYNKSVANRGNLYAY
    Newman          KQPVQQASKKVVVKQAPKQAVTKTVNVAYKPAQVQKSVPTVPVAHNYNKSVANRGNLYAY
    USA300_FPR3757  KQPVQQASKKVVVKQAPKQAVTKTVNVAYKPAQVQKSVPTVPVAHNYNKSVANRGNLYAY
                    *********************:**************************************

    COL             GNCTYYAFDRRAQLGRSIGSLWGNANNWNYAAKVAGFKVDKTPEVGAIFQTAAGPYGHVG
    N315            GNCTYYAFDRRAQLGRSIGSLWGNANNWNYAAKVAGFKVDKTPEVGAIFQTAAGPYGHVG
    NCTC8325        GNCTYYAFDRRAQLGRSIGSLWGNANNWNYAAKVAGFKVDKTPEVGAIFQTAAGPYGHVG
    Newman          GNCTYYAFDRRAQLGRSIGSLWGNANNWNYAAKVAGFKVDKTPEVGAIFQTAAGPYGHVG
    USA300_FPR3757  GNCTYYAFDRRAQLGRSIGSLWGNANNWNYAAKVAGFKVDKTPEVGAIFQTAAGPYGHVG
                    ************************************************************

    COL             VVESVNPNGTITVSEMNYAGFNVKSSRTILNPGKYNYIH
    N315            VVESVNPNGTITVSEMNYAGFNVKSSRTILNPGKYNYIH
    NCTC8325        VVESVNPNGTITVSEMNYAGFNVKSSRTILNPGKYNYIH
    Newman          VVESVNPNGTITVSEMNYAGFNVKSSRTILNPGKYNYIH
    USA300_FPR3757  VVESVNPNGTITVSEMNYAGFNVKSSRTILNPGKYNYIH
                    ***************************************