From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_0724 [new locus tag: NWMN_RS04100 ]
  • pan locus tag?: SAUPAN002669000
  • symbol: NWMN_0724
  • pan gene symbol?:
  • synonym:
  • product: hypothetical protein

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_0724 [new locus tag: NWMN_RS04100 ]
  • symbol: NWMN_0724
  • product: hypothetical protein
  • replicon: chromosome
  • strand: +
  • coordinates: 812270..813109
  • length: 840
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    721
    781
    ATGAAAAAATCTCTTACAGTGACGGTTTCGTCAGTGTTAGCTTTTTTAGCTTTAAATAAT
    GCAGCACATGCACAACAACATGGCACACAAGTAAAAACACCTGTTCAACATAATTATGTA
    TCAAATGTTCAAGCACAAACGCAATCACCGACAACTTATACAGTAGTTGCTGGCGATTCA
    TTATATAAGATTGCTTTAGAGCATCACTTAACGTTGAATCAATTATATTCATACAATCCT
    GGTGTAACACCTTTAATTTTTCCTGGTGACGTGATTTCACTTGTGCCTCAAAATAAAGTG
    AAACAAACTAAAGCGGTTAAATCACCAGTAAGAAAAGCAAGCCAAGCTAAAAAGGTAGTA
    AAACAACCTGTACAACAAGCATCTAAAAAAGTAGTAGTTAAGCAAGCACCTAAGCAAGCA
    GTAACTAAGACAGTTAATGTAGCATACAAACCTGCTCAAGTACAAAAATCAGTACCAACT
    GTACCTGTTGCACATAACTACAATAAATCAGTTGCTAACAGAGGAAACTTATATGCTTAT
    GGAAACTGCACATATTATGCTTTCGATCGTCGTGCACAATTAGGTAGAAGTATAGGAAGT
    TTATGGGGCAATGCAAATAACTGGAATTACGCAGCAAAAGTTGCAGGATTTAAAGTAGAT
    AAAACACCAGAAGTTGGCGCTATTTTCCAAACAGCTGCTGGTCCATATGGACATGTTGGT
    GTTGTTGAATCTGTAAACCCTAATGGAACAATTACTGTTTCTGAAATGAACTATGCTGGA
    TTTAATGTTAAATCTTCAAGAACAATTTTAAATCCAGGAAAATATAATTACATCCACTAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    720
    780
    840

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_0724 [new locus tag: NWMN_RS04100 ]
  • symbol: NWMN_0724
  • description: hypothetical protein
  • length: 279
  • theoretical pI: 10.557
  • theoretical MW: 30283.3
  • GRAVY: -0.304301

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    Cellular processesCellular processesSporulation and germinationspore coat assembly protein SafA (TIGR02899; HMM-score: 18.5)
    alternate signal-mediated exported protein, RER_14450 family (TIGR04089; HMM-score: 13.9)
  • TheSEED:  
    LysM domain protein 
  • PFAM:
    Peptidase_CA (CL0125) CHAP; CHAP domain (PF05257; HMM-score: 59.7)
    LysM (CL0187) LysM; LysM domain (PF01476; HMM-score: 35.5)
    no clan definedDUF521; Protein of unknown function (DUF521) (PF04412; HMM-score: 13.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Extracellular
    • Cytoplasmic Score: 0
    • Cytoplasmic Membrane Score: 0.09
    • Cellwall Score: 0.18
    • Extracellular Score: 9.73
    • Internal Helices: 0
  • LocateP: N-terminally anchored (with CS)
    • Prediction by SwissProt Classification: Membrane
    • Pathway Prediction: Sec-(SPI)
    • Intracellular Possibility: -0.17
    • Signal Peptide Possibility: 1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: NAAHAQQH
  • SignalP: Signal peptide length 25 aa
    • Ymax: 0.716
    • Ymax_pos: 25
    • Cmax: 0.573
    • Cmax_pos: 25
    • Smax: 0.963
    • Smax_pos: 20
    • Smean: 0.896
    • D: 0.786
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKKSLTVTVSSVLAFLALNNAAHAQQHGTQVKTPVQHNYVSNVQAQTQSPTTYTVVAGDSLYKIALEHHLTLNQLYSYNPGVTPLIFPGDVISLVPQNKVKQTKAVKSPVRKASQAKKVVKQPVQQASKKVVVKQAPKQAVTKTVNVAYKPAQVQKSVPTVPVAHNYNKSVANRGNLYAYGNCTYYAFDRRAQLGRSIGSLWGNANNWNYAAKVAGFKVDKTPEVGAIFQTAAGPYGHVGVVESVNPNGTITVSEMNYAGFNVKSSRTILNPGKYNYIH

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]