From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN006235000
  • symbol?: isaA
  • description?: immunodominant antigen A

      descriptions from strain specific annotations:

    • immunodominant antigen A
    • transglycosylase IsaA
    • immunodominant antigen A, transglycosylase isaA
    • Immunodominant antigen A precursor
    • immunodominant staphylococcal antigen A
    • Immunodominant staphylococcal antigen A precursor
    • putative transglycosylase isaA
    • transglycosylase domain-containing protein
    • transglycosylase-like domain protein
  • strand?: -
  • coordinates?: 6300436..6301137
  • synteny block?: BlockID0049590
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2584 (isaA)
    N315:
    SA2356 (isaA)
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_2506 (isaA)
    08BA02176:
    C248_2627 (isaA)
    11819-97:
    MS7_2575 (isaA)
    71193:
    ST398NM01_2619
    ECT-R 2:
    ECTR2_2423
    ED133:
    SAOV_2614c
    ED98:
    SAAV_2635 (isaA)
    HO 5096 0412:
    SAEMRSA15_24720 (isaA)
    JH1:
    SaurJH1_2646
    JH9:
    SaurJH9_2591
    JKD6008:
    SAA6008_02607 (isaA)
    JKD6159:
    SAA6159_02464 (isaA)
    LGA251:
    SARLGA251_23440 (isaA)
    M013:
    M013TW_2543
    MRSA252:
    SAR2650 (isaA)
    MSHR1132:
    SAMSHR1132_23850
    MSSA476:
    SAS2455
    Mu3:
    SAHV_2553 (isaA)
    Mu50:
    SAV2569 (isaA)
    MW2:
    MW2490 (isaA)
    RF122:
    SAB2443c (isaA)
    ST398:
    SAPIG2619
    T0131:
    SAT0131_02779
    TCH60:
    HMPREF0772_10621 (isaA)
    TW20:
    SATW20_26900 (isaA)
    USA300_TCH1516:
    USA300HOU_2564 (isaA)
    VC40:
    SAVC_11725

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKDGAY
    N315            MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKDGAY
    NCTC8325        MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKDGAY
    Newman          MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKDGAY
    USA300_FPR3757  MKKTIMASSLAVALGVTGYAAGTGHQAHAAEVNVDQAHLVDLAHNHQDQLNAAPIKDGAY
                    ************************************************************

    COL             DIHFVKDGFQYNFTSNGTTWSWSYEAANGQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQ
    N315            DIHFVKDGFQYNFTSNGTTWSWSYEAANGQTAGFSNVAGADYTTSYNQGSDVQSVSYNAQ
    NCTC8325        DIHFVKDGFQYNFTSNGTTWSWSYEAANGQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQ
    Newman          DIHFVKDGFQYNFTSNGTTWSWSYEAANGQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQ
    USA300_FPR3757  DIHFVKDGFQYNFTSNGTTWSWSYEAANGQTAGFSNVAGADYTTSYNQGSNVQSVSYNAQ
                    **************************************************:*********

    COL             SSNSNVEAVSAPTYHNYSTSTTSSSVRLSNGNTAGATGSSAAQIMAQRTGVSASTWAAII
    N315            SSNSNVEAVSAPTYHNYSTSTTSSSVRLSNGNTAGATGSSAAQIMAQRTGVSASTWAAII
    NCTC8325        SSNSNVEAVSAPTYHNYSTSTTSSSVRLSNGNTAGATGSSAAQIMAQRTGVSASTWAAII
    Newman          SSNSNVEAVSAPTYHNYSTSTTSSSVRLSNGNTAGATGSSAAQIMAQRTGVSASTWAAII
    USA300_FPR3757  SSNSNVEAVSAPTYHNYSTSTTSSSVRLSNGNTAGATGSSAAQIMAQRTGVSASTWAAII
                    ************************************************************

    COL             ARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQINAAVKAYKAQGLGAWGF
    N315            ARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQINAAVKAYKAQGLGAWGF
    NCTC8325        ARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQINAAVKAYKAQGLGAWGF
    Newman          ARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQINAAVKAYKAQGLGAWGF
    USA300_FPR3757  ARESNGQVNAYNPSGASGLFQTMPGWGPTNTVDQQINAAVKAYKAQGLGAWGF
                    *****************************************************