From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN001063000
  • symbol?:
  • description?: peptidase M23

      descriptions from strain specific annotations:

    • peptidase M23
    • M23/M37 peptidase domain-containing protein
    • M23/M37 peptidase domain protein
    • M23 family peptidase
    • peptidase family M23 family protein
    • peptidase M23B
    • peptidase M23 family protein
    • putative peptidase
  • strand?: +
  • coordinates?: 1340143..1340733
  • synteny block?: BlockID0005850
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    N315:
    NCTC8325:
    Newman:
    USA300_FPR3757:
    04-02981:
    SA2981_0213
    08BA02176:
    C248_0196
    11819-97:
    MS7_0198
    71193:
    ST398NM01_0222
    ECT-R 2:
    ECTR2_173
    ED133:
    SAOV_0150
    ED98:
    SAAV_0178
    HO 5096 0412:
    SAEMRSA15_01710
    JH1:
    SaurJH1_0203
    JH9:
    SaurJH9_0197
    JKD6008:
    SAA6008_00181
    JKD6159:
    SAA6159_00187
    LGA251:
    SARLGA251_01760
    M013:
    M013TW_0192
    MRSA252:
    SAR0204
    MSHR1132:
    SAMSHR1132_01780
    MSSA476:
    SAS0188
    Mu3:
    SAHV_0211
    Mu50:
    SAV0212
    MW2:
    MW0188
    RF122:
    SAB0150
    ST398:
    SAPIG0222
    T0131:
    SAT0131_00197 (dnaJ)
    TCH60:
    HMPREF0772_10295
    TW20:
    SATW20_02130
    USA300_TCH1516:
    USA300HOU_0219
    VC40:
    SAVC_00800

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MTKRPKRILATIIIFLSLLFTIIYIDDIQKWFNQYTDKLTQNHKGQGHSKWEDFFRGSRI
    N315            MTKRPKRILATIIIFLSLLFTIIYIDDIQKWFNQYTDKLTQNHKGQGHSKWEDFFRGSRI
    NCTC8325        MTKRPKRILATIIIFLSLLFTIIYIDDIQKWFNQYTDKLTQNHKGQGHSKWEDFFRGSRI
    Newman          MTKRPKRILATIIIFLSLLFTIIYIDDIQKWFNQYTDKLTQNHKGQGHSKWEDFFRGSRI
    USA300_FPR3757  MTKRPKRILATIIIFLSLLFTIIYIDDIQKWFNQYTDKLTQNHKGQGHSKWEDFFRGSRI
                    ************************************************************

    COL             TETFGKYQHSPFDGKHYGIDFALPKGTPIKAPTNGKVTRIFNNELGGKVLQIAEDNGEYH
    N315            TETFGKYQHSPFDGKHYGIDFALPKGTPIKAPTNGKVTRIFNNELGGKVLQIAEDNGEYH
    NCTC8325        TETFGKYQHSPFDGKHYGIDFALPKGTPIKAPTNGKVTRIFNNELGGKVLQIAEDNGEYH
    Newman          TETFGKYQHSPFDGKHYGIDFALPKGTPIKAPTNGKVTRIFNNELGGKVLQIAEDNGEYH
    USA300_FPR3757  TETFGKYQHSPFDGKHYGIDFALPKGTPIKAPTNGKVTRIFNNELGGKVLQIAEDNGEYH
                    ************************************************************

    COL             QWYLHLDKYNVKVGDRVKAGDIIAYSGNTGIQTTGAHLHFQRMKGGVGNAYAEDPKPFID
    N315            QWYLHLDKYNVKVGDRVKAGDIIAYSGNTGKQTTGAHLHFQRMKGGVGNAYAEDPKPFIE
    NCTC8325        QWYLHLDKYNVKVGDRVKAGDIIAYSGNTGIQTTGAHLHFQRMKGGVGNAYAEDPKPFID
    Newman          QWYLHLDKYNVKVGDRVKAGDIIAYSGNTGIQTTGAHLHFQRMKGGVGNAYAEDPKPFID
    USA300_FPR3757  QWYLHLDKYNVKVGDRVKAGDIIAYSGNTGIQTTGAHLHFQRMKGGVGNAYAEDPKPFID
                    ****************************** ****************************:

    COL             QLPDGERSLYDL
    N315            QLPDGERSLYDL
    NCTC8325        QLPDGERSLYDL
    Newman          QLPDGERSLYDL
    USA300_FPR3757  QLPDGERSLYDL
                    ************