From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2237 [new locus tag: NWMN_RS12890 ]
  • pan locus tag?: SAUPAN005825000
  • symbol: rpi
  • pan gene symbol?: rpiA
  • synonym:
  • product: ribose-5-phosphate isomerase A

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2237 [new locus tag: NWMN_RS12890 ]
  • symbol: rpi
  • product: ribose-5-phosphate isomerase A
  • replicon: chromosome
  • strand: -
  • coordinates: 2460592..2461278
  • length: 687
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    481
    541
    601
    661
    ATGAAAGATGTCAAAGCACTCAAGTTAATGACATTAAATGATGTTTTAAGTCAAATCAAT
    GGTGACATGACGCTGGGAATTGGTACAGGAAGTACAATGGAATTACTCTTACCTCAAATG
    GCGCAACTAATTAAAGAACGTGGTTACAATATTACAGGTGTATGCACTTCTAATAAAATT
    GCATTTTTAGCAAAAGAATTAGGTATTAAAATATGTGAAATCAATGATGTTGATCATATC
    GACTTAGCAATTGATGGTGCTGATGAAGTAGATCCATCTTTAAATATAATTAAAGGTGGC
    GGTGGTGCGCTGTTCAGAGAGAAAGTTATAGATGAAATGGCATCGCGTTTTGTTGTGGTT
    GTCGATGAAACGAAAATAGTTCAATACTTAGGTGAGACGTTTAAGTTACCAGTAGAGGTG
    GATAAATTTAACTGGTATCACATATTACGTAAAATTGAATCATACGCTGATATAAAAGTA
    GAACGTCGTGTAAACGAAGATGTCGCATTTATAACTGATAATGGCAATTATATTTTAGAT
    TGTAAGTTACCAAAAGGAATTGACCCATATAAGTTCCATGAGTATTTAATTCATCTGACA
    GGTGTGTTTGAGACAGGATACTTCTTAGATATGGCAGATCAAGTTATTGTAGGCACTCAA
    GAGGGTGTTAAAATTTTAGAAAAATAA
    60
    120
    180
    240
    300
    360
    420
    480
    540
    600
    660
    687

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2237 [new locus tag: NWMN_RS12890 ]
  • symbol: Rpi
  • description: ribose-5-phosphate isomerase A
  • length: 228
  • theoretical pI: 4.62139
  • theoretical MW: 25549.4
  • GRAVY: 0.020614

Function[edit source | edit]

  • reaction:
    EC 5.3.1.6?  ExPASy
    Ribose-5-phosphate isomeraseD-ribose 5-phosphate = D-ribulose 5-phosphate
  • TIGRFAM:
    MetabolismEnergy metabolismPentose phosphate pathwayribose 5-phosphate isomerase A (TIGR00021; EC 5.3.1.6; HMM-score: 262.3)
  • TheSEED:  
    CarbohydratesCentral carbohydrate metabolismDihydroxyacetone kinases Ribose 5-phosphate isomerase A (EC 5.3.1.6) 
    Central carbohydrate metabolismGlycolate, glyoxylate interconversions Ribose 5-phosphate isomerase A (EC 5.3.1.6) 
    Central carbohydrate metabolismPentose phosphate pathway Ribose 5-phosphate isomerase A (EC 5.3.1.6) 
    MonosaccharidesD-ribose utilization Ribose 5-phosphate isomerase A (EC 5.3.1.6) 
  • PFAM:
    ISOCOT_Fold (CL0246) Rib_5-P_isom_A; Ribose 5-phosphate isomerase A (phosphoriboisomerase A) (PF06026; HMM-score: 200.6)
    DeoRC; DeoR C terminal sensor domain (PF00455; HMM-score: 15.3)
    no clan definedFlavoprotein; Flavoprotein (PF02441; HMM-score: 12.4)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.16
    • Ymax_pos: 11
    • Cmax: 0.126
    • Cmax_pos: 44
    • Smax: 0.383
    • Smax_pos: 1
    • Smean: 0.221
    • D: 0.184
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MKDVKALKLMTLNDVLSQINGDMTLGIGTGSTMELLLPQMAQLIKERGYNITGVCTSNKIAFLAKELGIKICEINDVDHIDLAIDGADEVDPSLNIIKGGGGALFREKVIDEMASRFVVVVDETKIVQYLGETFKLPVEVDKFNWYHILRKIESYADIKVERRVNEDVAFITDNGNYILDCKLPKGIDPYKFHEYLIHLTGVFETGYFLDMADQVIVGTQEGVKILEK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

  • rpi no polycistronic organisation predicted

Regulation[edit source | edit]

  • sigma factor:
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]