From AureoWiki
Jump to: navigation, search
NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2258 [new locus tag: NWMN_RS13005 ]
  • pan locus tag?: SAUPAN005864000
  • symbol: tcaR
  • pan gene symbol?: tcaR
  • synonym:
  • product: teicoplanin resistance operon transcriptional regulator TcaR

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2258 [new locus tag: NWMN_RS13005 ]
  • symbol: tcaR
  • product: teicoplanin resistance operon transcriptional regulator TcaR
  • replicon: chromosome
  • strand: -
  • coordinates: 2481279..2481734
  • length: 456
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

  • Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    361
    421
    ATGGTAAAACATTTACAAGACCATATTCAATTTTTAGAGCAGTTTATAAATAACGTTAAC
    GCATTAACTGCAAAAATGTTGAAAGATTTACAAAATGAATATGAAATTTCATTAGAGCAG
    TCTAACGTATTAGGTATGTTAAATAAAGAACCTTTGACAATTAGTGAAATCACGCAAAGA
    CAAGGTGTAAATAAGGCCGCAGTAAGCCGACGAATTAAAAAGTTAATCGATGCTAAATTA
    GTTAAGTTAGATAAACCAAATTTAAATATTGATCAACGTTTGAAATTCATAACCTTAACT
    GACAAAGGTAGAGCATATTTGAAAGAACGTAATGCGATTATGACAGATATTGCGCAAGAT
    ATTACTAATGATTTAAATTCTGAAGATATTGAAAATGTAAGGCAAGTATTAGAAGTCATC
    AATCATCGCATTAAAACATATAGCAATCATAAATAG
    60
    120
    180
    240
    300
    360
    420
    456

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2258 [new locus tag: NWMN_RS13005 ]
  • symbol: TcaR
  • description: teicoplanin resistance operon transcriptional regulator TcaR
  • length: 151
  • theoretical pI: 9.72614
  • theoretical MW: 17521.1
  • GRAVY: -0.525828

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    homoprotocatechuate degradation operon regulator, HpaR (TIGR02337; HMM-score: 27.1)
    Genetic information processingDNA metabolismDNA replication, recombination, and repairDnaD family protein (TIGR04548; HMM-score: 23)
    mobile rSAM pair MarR family regulator (TIGR04472; HMM-score: 15.3)
    RNA polymerase sigma factor, sigma-70 family (TIGR02937; HMM-score: 14)
    Signal transductionRegulatory functionsDNA interactionstranscriptional regulator, Acidobacterial, PadR-family (TIGR03433; HMM-score: 14)
    Cellular processesCellular processesSporulation and germinationstage II sporulation protein E (TIGR02865; EC 3.1.3.16; HMM-score: 7.9)
  • TheSEED:  
    Regulation and Cell signalingQuorum sensing and biofilm formationBiofilm formation in Staphylococcus Teicoplanin-resistance associated HTH-type transcriptional regulator TcaR 
    Virulence, Disease and DefenseResistance to antibiotics and toxic compoundsTeicoplanin-resistance in Staphylococcus Teicoplanin-resistance associated HTH-type transcriptional regulator TcaR 
  • PFAM:
    HTH (CL0123) MarR_2; MarR family (PF12802; HMM-score: 39.4)
    HTH_20; Helix-turn-helix domain (PF12840; HMM-score: 26.8)
    HTH_5; Bacterial regulatory protein, arsR family (PF01022; HMM-score: 25.7)
    HTH_27; Winged helix DNA-binding domain (PF13463; HMM-score: 25)
    HTH_24; Winged helix-turn-helix DNA-binding (PF13412; HMM-score: 23.2)
    HTH_11; HTH domain (PF08279; HMM-score: 22.5)
    MarR; MarR family (PF01047; HMM-score: 22.4)
    HTH_IclR; IclR helix-turn-helix domain (PF09339; HMM-score: 20.1)
    Rrf2; Transcriptional regulator (PF02082; HMM-score: 19.5)
    TrmB; Sugar-specific transcriptional regulator TrmB (PF01978; HMM-score: 19)
    HTH_34; Winged helix DNA-binding domain (PF13601; HMM-score: 18.7)
    Sigma70_r4; Sigma-70, region 4 (PF04545; HMM-score: 15.4)
    UPF0122; Putative helix-turn-helix protein, YlxM / p13 like (PF04297; HMM-score: 15.2)
    Peptidase_CD (CL0093) Peptidase_C11; Clostripain family (PF03415; HMM-score: 15)
    HTH (CL0123) HTH_45; Winged helix-turn-helix (PF14947; HMM-score: 14.1)
    Globin (CL0090) Protoglobin; Protoglobin (PF11563; HMM-score: 13.4)
    no clan definedZapB; Cell division protein ZapB (PF06005; HMM-score: 11.5)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.119
    • Ymax_pos: 22
    • Cmax: 0.118
    • Cmax_pos: 22
    • Smax: 0.165
    • Smax_pos: 21
    • Smean: 0.121
    • D: 0.12
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • MVKHLQDHIQFLEQFINNVNALTAKMLKDLQNEYEISLEQSNVLGMLNKEPLTISEITQRQGVNKAAVSRRIKKLIDAKLVKLDKPNLNIDQRLKFITLTDKGRAYLKERNAIMTDIAQDITNDLNSEDIENVRQVLEVINHRIKTYSNHK

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor: SigB [1] other strains
    SigB (sigma factor) controls a large regulon involved in stress/starvation response and adaptation
  • regulator:

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

  1. Bettina Schulthess, Dominik A Bloes, Patrice François, Myriam Girard, Jacques Schrenzel, Markus Bischoff, Brigitte Berger-Bächi
    The σB-dependent yabJ-spoVG operon is involved in the regulation of extracellular nuclease, lipase, and protease expression in Staphylococcus aureus.
    J. Bacteriol.: 2011, 193(18);4954-62
    [PubMed:21725011] [WorldCat.org] [DOI] (I p)

Relevant publications[edit source | edit]