From AureoWiki
Jump to: navigation, search

Summary[edit source | edit]

  • pan ID?: SAUPAN005864000
  • symbol?: tcaR
  • description?: transcriptional regulator

      descriptions from strain specific annotations:

    • transcriptional regulator
    • transcriptional regulator TcaR
    • TcaR transcription regulator
    • teicoplanin resistance operon transcriptional regulator TcaR
    • Teicoplanin-resistance associated HTH-type transcriptional regulator TcaR
    • bicyclomycin resistance transcriptional regulator
    • HTH-type transcriptional regulator tcaR
    • marR family protein
    • MarR family regulatory protein
    • MarR family transcriptional regulator
  • strand?: -
  • coordinates?: 5937774..5938229
  • synteny block?: BlockID0046090
  • occurrence?: in 100% of 32 strains

Orthologs[edit source | edit]

    COL:
    SACOL2353 (tcaR)
    N315:
    SA2147 (tcaR)
    NCTC8325:
    Newman:
    NWMN_2258 (tcaR)
    USA300_FPR3757:
    04-02981:
    SA2981_2296 (tcaR)
    08BA02176:
    C248_2402 (tcaR)
    11819-97:
    MS7_2375 (tcaR)
    71193:
    ST398NM01_2410
    ECT-R 2:
    ECTR2_2217
    ED133:
    SAOV_2401c
    ED98:
    SAAV_2422 (tcaR)
    HO 5096 0412:
    SAEMRSA15_22550 (tcaR)
    JH1:
    SaurJH1_2427
    JH9:
    SaurJH9_2381
    JKD6008:
    SAA6008_02394 (tcaR)
    JKD6159:
    SAA6159_02261 (tcaR)
    LGA251:
    SARLGA251_21390 (tcaR)
    M013:
    M013TW_2315
    MRSA252:
    SAR2443 (tcaR)
    MSHR1132:
    SAMSHR1132_21820
    MSSA476:
    SAS2248
    Mu3:
    SAHV_2341 (tcaR)
    Mu50:
    SAV2357 (tcaR)
    MW2:
    MW2278 (tcaR)
    RF122:
    SAB2236c (tcaR)
    ST398:
    SAPIG2410
    T0131:
    SAT0131_02544
    TCH60:
    HMPREF0772_10835 (tcaR)
    TW20:
    SATW20_24880 (tcaR)
    USA300_TCH1516:
    USA300HOU_2339 (tcaR)
    VC40:
    SAVC_10641 (tcaR)

Genome Viewer[edit source | edit]

COL chromosome
N315 chromosome
NCTC8325 chromosome
Newman chromosome
USA300_FPR3757 chromosome

Alignments[edit source | edit]

  • alignment of orthologues:
    CLUSTAL format alignment by MAFFT L-INS-i (v7.205)


    COL             MVKHLQDHIQFLEQFINNVNALTAKMLKDLQNEYEISLEQSNVLGMLNKEPLTISEITQR
    N315            MVKHLQDHIQFLEQFINNVNALTAKMLKDLQNEYEISLEQSNVLGMLNKEPLTISEITQR
    Newman          MVKHLQDHIQFLEQFINNVNALTAKMLKDLQNEYEISLEQSNVLGMLNKEPLTISEITQR
    USA300_FPR3757  MVKHLQDHIQFLEQFINNVNALTAKMLKDLQNEYEISLEQSNVLGMLNKEPLTISEITQR
                    ************************************************************

    COL             QGVNKAAVSRRIKKLIDAKLVKLDKPNLNIDQRLKFITLTDKGRAYLKERNAIMTDIAQD
    N315            QGVNKAAVSRRIKKLIDAKLVKLDKPNLNIDQRLKFITLTDKGRAYLKERNAIMTDIAQD
    Newman          QGVNKAAVSRRIKKLIDAKLVKLDKPNLNIDQRLKFITLTDKGRAYLKERNAIMTDIAQD
    USA300_FPR3757  QGVNKAAVSRRIKKLIDAKLVKLDKPNLNIDQRLKFITLTDKGRAYLKERNAIMTDIAQD
                    ************************************************************

    COL             ITNDLNSEDIENVRQVLEVINHRIKTYSNHK
    N315            ITNDLNSEDIENVRQVLEVINHRIKTYSNHK
    Newman          ITNDLNSEDIENVRQVLEVINHRIKTYSNHK
    USA300_FPR3757  ITNDLNSEDIENVRQVLEVINHRIKTYSNHK
                    *******************************