From AureoWiki
Jump to: navigation, search

NCBI: 06-JUL-2013

Summary[edit source | edit]

  • organism: Staphylococcus aureus Newman
  • locus tag: NWMN_2299 [new locus tag: NWMN_RS13220 ]
  • pan locus tag?: SAUPAN005931000
  • symbol: nirD
  • pan gene symbol?: nasE
  • synonym:
  • product: assimilatory nitrite reductase [NAD(P)H], small subunit

Genome View[edit source | edit]

Gene[edit source | edit]

General[edit source | edit]

  • type: CDS
  • locus tag: NWMN_2299 [new locus tag: NWMN_RS13220 ]
  • symbol: nirD
  • product: assimilatory nitrite reductase [NAD(P)H], small subunit
  • replicon: chromosome
  • strand: -
  • coordinates: 2526690..2527004
  • length: 315
  • essential: unknown other strains

Accession numbers[edit source | edit]

Phenotype[edit source | edit]

Share your knowledge and add information here. [edit]

DNA sequence[edit source | edit]

  • 1
    61
    121
    181
    241
    301
    ATGGAAACAAAAGAAAAAATTAAAGTGACAACTATAGATGAATTAACACCCCTAATTGGA
    AAAAAGGTTATTGTCAAAGGCAAAGAGGTAGGGTTGTTTTTAACAGAAAGTGGCAAAATT
    CATGCGATTCACAATATCTGTCCACACAAACAAGGACCATTGTCTGAAGGGACAGTGAGT
    GGGGAATATGTATTTTGCCCGCTCCACGATCAAAAAATTGATTTAAATACAGGTATTGTT
    CAAGAACCTGATGAAGGTTGTGTAGATGTTTATGAGGTAGAAGTTACAGACGGGAACGTA
    TATATATGTCTGTAG
    60
    120
    180
    240
    300
    315

Protein[edit source | edit]

General[edit source | edit]

  • locus tag: NWMN_2299 [new locus tag: NWMN_RS13220 ]
  • symbol: NirD
  • description: assimilatory nitrite reductase [NAD(P)H], small subunit
  • length: 104
  • theoretical pI: 4.70663
  • theoretical MW: 11437.1
  • GRAVY: -0.106731

Function[edit source | edit]

  • reaction:
  • TIGRFAM:
    MetabolismCentral intermediary metabolismNitrogen metabolismnitrite reductase [NAD(P)H], small subunit (TIGR02378; EC 1.7.1.4; HMM-score: 82.3)
    Rieske [2Fe-2S] domain protein, MocE subfamily (TIGR02377; HMM-score: 35.7)
  • TheSEED:  
    Nitrogen MetabolismNitrogen Metabolism - no subcategoryNitrate and nitrite ammonification Nitrite reductase [NAD(P)H] small subunit (EC 1.7.1.4) 
  • PFAM:
    ISP-domain (CL0516) Rieske_2; Rieske-like [2Fe-2S] domain (PF13806; HMM-score: 65.1)
    Rieske; Rieske [2Fe-2S] domain (PF00355; HMM-score: 43)

Structure, modifications & interactions[edit source | edit]

  • domains:
  • modifications:
  • cofactors:
  • effectors:
  • protein partners:

Localization[edit source | edit]

  • PSORTb: Cytoplasmic
    • Cytoplasmic Score: 7.5
    • Cytoplasmic Membrane Score: 1.15
    • Cellwall Score: 0.62
    • Extracellular Score: 0.73
    • Internal Helices: 0
  • LocateP: Intracellular
    • Prediction by SwissProt Classification: Cytoplasmic
    • Pathway Prediction: No pathway
    • Intracellular Possibility: 1
    • Signal Peptide Possibility: -1
    • N-terminally Anchored Score: 1
    • Predicted Cleavage Site: No CleavageSite
  • SignalP: no predicted signal peptide
    • Ymax: 0.164
    • Ymax_pos: 43
    • Cmax: 0.164
    • Cmax_pos: 43
    • Smax: 0.238
    • Smax_pos: 39
    • Smean: 0.12
    • D: 0.147
  • predicted transmembrane helices (TMHMM): 0

Accession numbers[edit source | edit]

Protein sequence[edit source | edit]

  • METKEKIKVTTIDELTPLIGKKVIVKGKEVGLFLTESGKIHAIHNICPHKQGPLSEGTVSGEYVFCPLHDQKIDLNTGIVQEPDEGCVDVYEVEVTDGNVYICL

Experimental data[edit source | edit]

  • experimentally validated: no data available

Expression & Regulation[edit source | edit]

Operon[edit source | edit]

Regulation[edit source | edit]

  • sigma factor:
  • regulators: NWMN_1953 (Rex*), NWMN_2291 (NreC*)
    Rex* (TF) important in Energy metabolism  RegPrecise    transcription unit transferred from N315 data RegPrecise
    NreC* (TF) important in Nitrate and nitrite respiration  RegPrecise    transcription unit transferred from N315 data RegPrecise

Transcription pattern[edit source | edit]

Protein synthesis (provided by Aureolib)[edit source | edit]

Protein stability[edit source | edit]

  • half-life: no data available

Biological Material[edit source | edit]

Mutants[edit source | edit]

Expression vector[edit source | edit]

lacZ fusion[edit source | edit]

GFP fusion[edit source | edit]

two-hybrid system[edit source | edit]

FLAG-tag construct[edit source | edit]

Antibody[edit source | edit]

Other Information[edit source | edit]

You are kindly invited to share additional interesting facts.

Literature[edit source | edit]

References[edit source | edit]

Relevant publications[edit source | edit]